BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_B20 (512 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24012| Best HMM Match : RRM_1 (HMM E-Value=0.69) 28 3.9 SB_51379| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 >SB_24012| Best HMM Match : RRM_1 (HMM E-Value=0.69) Length = 166 Score = 28.3 bits (60), Expect = 3.9 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = +3 Query: 210 AQATMSTAMWSLFFIVQILLNVSGHSVLDPDTLKDVFGEQDQKYNSPF 353 A +S A + ++LLNV HS++ + +KD+ + +KY F Sbjct: 62 ATGFISRAFVEFVVVHKMLLNVKLHSLMSKENVKDLKSGRSKKYGFVF 109 >SB_51379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 28.3 bits (60), Expect = 3.9 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -3 Query: 435 PSSQDQQGLHYPE*QPLLEQRIPPPLVQ 352 PSS DQ L QPL+E+ I PP ++ Sbjct: 97 PSSVDQSALDQVPQQPLIEELIDPPSME 124 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,252,936 Number of Sequences: 59808 Number of extensions: 255448 Number of successful extensions: 478 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 454 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 478 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1136110413 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -