BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_B14 (603 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 49 3e-08 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 23 2.3 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 23 3.0 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 7.0 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 21 7.0 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 21 7.0 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 21 7.0 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 21 7.0 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 9.3 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 9.3 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 49.2 bits (112), Expect = 3e-08 Identities = 19/60 (31%), Positives = 35/60 (58%), Gaps = 1/60 (1%) Frame = +1 Query: 247 DPCMKVHCSAGRVCEINEHGE-AICNCIKECPYETDSRRKVCTNFNETWSSDCEVYRQRC 423 DPC +C G+ CE++ + A+C C+++CP R VC + + +++ CE++R C Sbjct: 80 DPCASKYCGIGKECELSPNSTIAVCVCMRKCPRR---HRPVCASNGKIYANHCELHRAAC 136 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 23.0 bits (47), Expect = 2.3 Identities = 13/48 (27%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = +3 Query: 30 KTSSTPSALTYDDYGAADVGGASP--RGHLRVGAPRERHGGEPGRETI 167 +T+S+PS + +SP +G G P +R+GGE ++ + Sbjct: 506 ETNSSPSPNPRIASAPSSSTSSSPPAKGAAAAGQPSKRNGGETNKQEL 553 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 22.6 bits (46), Expect = 3.0 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 3/25 (12%) Frame = -3 Query: 436 GRG---RGSAVGTPRSPMTRSR*SL 371 GRG GS G+PRSP + SR S+ Sbjct: 310 GRGSVHNGSNNGSPRSPESNSRCSV 334 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.4 bits (43), Expect = 7.0 Identities = 12/39 (30%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +1 Query: 487 YGTCREMPEC--SENEMSDFPRRMRDWLFNIMRDLAERR 597 + C ++ E S NE++ P +RD DL E R Sbjct: 427 FRNCSDLKELDLSGNELTSVPDALRDLALLKTLDLGENR 465 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 21.4 bits (43), Expect = 7.0 Identities = 12/45 (26%), Positives = 18/45 (40%) Frame = +3 Query: 6 LHGRRRGPKTSSTPSALTYDDYGAADVGGASPRGHLRVGAPRERH 140 +HGR R K S +A+ ++ V H R+G H Sbjct: 365 MHGRGRSGKKSKFNAAVAAAVQSSSIVSSPDSARHQRIGGCNGLH 409 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 7.0 Identities = 12/53 (22%), Positives = 18/53 (33%) Frame = -3 Query: 586 PGRALC*TASRACAAGSLTFRSRCTPAFPCKSRSTRSARGGTAPRGTAPSGRG 428 PG L + C + R CK+ + + RGG G+G Sbjct: 536 PGAPLDSKLCQQCVGNLASNNDRIRQVTKCKATNEETYRGGKGALSCLLDGKG 588 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 7.0 Identities = 12/53 (22%), Positives = 18/53 (33%) Frame = -3 Query: 586 PGRALC*TASRACAAGSLTFRSRCTPAFPCKSRSTRSARGGTAPRGTAPSGRG 428 PG L + C + R CK+ + + RGG G+G Sbjct: 536 PGAPLDSKLCQQCVGNLASNNDRIRQVTKCKATNEETYRGGKGALSCLLDGKG 588 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 7.0 Identities = 12/53 (22%), Positives = 18/53 (33%) Frame = -3 Query: 586 PGRALC*TASRACAAGSLTFRSRCTPAFPCKSRSTRSARGGTAPRGTAPSGRG 428 PG L + C + R CK+ + + RGG G+G Sbjct: 536 PGAPLDSKLCQQCVGNLASNNDRIRQVTKCKATNEETYRGGKGALSCLLDGKG 588 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.0 bits (42), Expect = 9.3 Identities = 10/41 (24%), Positives = 20/41 (48%) Frame = +1 Query: 121 EHLENGMAESLDERRFQEAERARVSEILNESRDAPDNEINL 243 E L NG+ L +R + ++ A + + + + D IN+ Sbjct: 830 EILANGVLSDLSIKRTERSDSALFTCVATNAFGSDDTSINM 870 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.0 bits (42), Expect = 9.3 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +1 Query: 100 RGDISESEHLENGMAESLDERRFQEAERA 186 R D E+E E+G +S E+R + E A Sbjct: 280 RDDDEENEEEEDGRGQSEAEKRLKLDEDA 308 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,246 Number of Sequences: 438 Number of extensions: 3855 Number of successful extensions: 13 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17726685 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -