BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_B14 (603 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g37720.1 68418.m04541 RNA and export factor-binding protein, ... 33 0.11 At3g53970.1 68416.m05963 proteasome inhibitor-related similar to... 32 0.25 At5g13480.1 68418.m01554 WD-40 repeat family protein similar to ... 31 0.59 At3g56600.1 68416.m06294 phosphatidylinositol 3- and 4-kinase fa... 31 0.59 At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containi... 30 1.4 At3g57630.2 68416.m06421 exostosin family protein contains Pfam ... 29 1.8 At3g57630.1 68416.m06420 exostosin family protein contains Pfam ... 29 1.8 At5g01950.1 68418.m00114 leucine-rich repeat transmembrane prote... 29 3.1 At3g26720.1 68416.m03341 glycosyl hydrolase family 38 protein si... 29 3.1 At3g13490.1 68416.m01697 tRNA synthetase class II (D, K and N) f... 29 3.1 At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR... 28 4.1 At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR... 28 4.1 At1g64140.1 68414.m07266 expressed protein similar to putative d... 28 4.1 At1g15190.1 68414.m01816 hypothetical protein 28 4.1 At5g09670.2 68418.m01119 loricrin-related contains weak similari... 27 7.2 At5g09670.1 68418.m01118 loricrin-related contains weak similari... 27 7.2 At3g15820.1 68416.m02002 phosphatidic acid phosphatase-related /... 27 7.2 At2g32660.1 68415.m03992 disease resistance family protein / LRR... 27 7.2 At5g64550.1 68418.m08112 loricrin-related contains weak similari... 27 9.6 At5g60930.1 68418.m07643 chromosome-associated kinesin, putative... 27 9.6 At5g22010.1 68418.m02561 AAA-type ATPase family protein / BRCT d... 27 9.6 At4g29310.1 68417.m04190 expressed protein 27 9.6 At1g63700.1 68414.m07209 protein kinase, putative contains prote... 27 9.6 >At5g37720.1 68418.m04541 RNA and export factor-binding protein, putative transcriptional coactivator ALY, Mus musculus, EMBL:MMU89876 Length = 288 Score = 33.5 bits (73), Expect = 0.11 Identities = 17/47 (36%), Positives = 21/47 (44%) Frame = -3 Query: 523 SRCTPAFPCKSRSTRSARGGTAPRGTAPSGRGRGSAVGTPRSPMTRS 383 SR P + R RGG RG GRGRG G + P+ +S Sbjct: 223 SRRLPIHNQQGGGMRGGRGGFRARGRGNGGRGRGGGRGNGKKPVEKS 269 >At3g53970.1 68416.m05963 proteasome inhibitor-related similar to proteasome inhibitor PI31 subunit (hPI31) SP:Q92530 from [Homo sapiens] Length = 302 Score = 32.3 bits (70), Expect = 0.25 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = +3 Query: 27 PKTSSTPSALTYDDYGAADVGGASPRGHLRVGAPRERHGGEPGRETIPGG 176 P P +D YG V G P G PR GG P E PGG Sbjct: 250 PHPGMPPPGARFDPYGPPGVPGFEP-GRFTRQPPRGPGGGHPDLEHFPGG 298 >At5g13480.1 68418.m01554 WD-40 repeat family protein similar to WD-repeat protein WDC146 (SP:Q9C0J8|) {Homo sapiens}; contains 3 weak Pfam PF00400: WD domain, G-beta repeats; Length = 711 Score = 31.1 bits (67), Expect = 0.59 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +3 Query: 426 LPRPLGAVPRGAVPPRADRVLRDLQGNAGVQRERNVRLPAAH 551 LPRP+ P G +PP + + + G+ G+Q N ++ +H Sbjct: 608 LPRPMQMPPHGHMPPPSMPMSHQMPGSMGMQGGMNPQMSQSH 649 >At3g56600.1 68416.m06294 phosphatidylinositol 3- and 4-kinase family protein low similarity to 55 kDa type II phosphatidylinositol 4-kinase [Rattus norvegicus] GI:13660755; contains Pfam profile PF00454: Phosphatidylinositol 3- and 4-kinase Length = 533 Score = 31.1 bits (67), Expect = 0.59 Identities = 16/52 (30%), Positives = 27/52 (51%) Frame = -2 Query: 443 SEWSRQRQRCRYTSQSDDQVSLKFVHTLRLESVSYGHSLMQLQIASPCSLIS 288 S++SR QRCR S ++ + +T + + HSL +++PC IS Sbjct: 13 SQFSRSSQRCRLQSLTNLDFNFLGFNTKQTNLSASSHSLNNRSVSTPCFSIS 64 >At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containing protein similar to Hsc70-interacting protein (Hip) from {Homo sapiens} SP|P50502, {Rattus norvegicus} SP|P50503; contains Pfam profile PF00515: tetratricopeptide repeat (TPR) domain Length = 441 Score = 29.9 bits (64), Expect = 1.4 Identities = 21/52 (40%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +3 Query: 72 GAADVGGASPRGHLRVGAPRERHGGEPGRETIPGG*E-SSCLRDPE*VTRCS 224 G +GG P G G P GG PG +PGG + S L DPE +T S Sbjct: 349 GMPGMGGGMPAGMGGGGMPGAG-GGMPGGGGMPGGMDFSKILNDPELMTAFS 399 >At3g57630.2 68416.m06421 exostosin family protein contains Pfam profile: PF03016 exostosin family Length = 791 Score = 29.5 bits (63), Expect = 1.8 Identities = 17/68 (25%), Positives = 27/68 (39%), Gaps = 1/68 (1%) Frame = +1 Query: 208 ESRDAPDNEINLDDPC-MKVHCSAGRVCEINEHGEAICNCIKECPYETDSRRKVCTNFNE 384 + DA ++ + + C K C GR CEI C C+ +C R C Sbjct: 240 DPEDAYAMKVKIKEECDCKYDCLWGRFCEIPVQ----CTCVNQCSGHGKCRGGFCQCDKG 295 Query: 385 TWSSDCEV 408 + +DC + Sbjct: 296 WFGTDCSI 303 >At3g57630.1 68416.m06420 exostosin family protein contains Pfam profile: PF03016 exostosin family Length = 793 Score = 29.5 bits (63), Expect = 1.8 Identities = 17/68 (25%), Positives = 27/68 (39%), Gaps = 1/68 (1%) Frame = +1 Query: 208 ESRDAPDNEINLDDPC-MKVHCSAGRVCEINEHGEAICNCIKECPYETDSRRKVCTNFNE 384 + DA ++ + + C K C GR CEI C C+ +C R C Sbjct: 242 DPEDAYAMKVKIKEECDCKYDCLWGRFCEIPVQ----CTCVNQCSGHGKCRGGFCQCDKG 297 Query: 385 TWSSDCEV 408 + +DC + Sbjct: 298 WFGTDCSI 305 >At5g01950.1 68418.m00114 leucine-rich repeat transmembrane protein kinase, putative receptor protein kinases Length = 1032 Score = 28.7 bits (61), Expect = 3.1 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -2 Query: 248 SSRLISLSGASRDSFRISETRALSASWNRLSSRLSAMPFSR 126 S R SL GA D +I + L SWN L+ + + FS+ Sbjct: 334 SLRNCSLKGALPDFSKIRHLKYLDLSWNELTGPIPSSNFSK 374 >At3g26720.1 68416.m03341 glycosyl hydrolase family 38 protein similar to lysosomal alpha-mannosidase GI:3522867 from [Homo sapiens] Length = 1019 Score = 28.7 bits (61), Expect = 3.1 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +1 Query: 127 LENGMAESLDERRFQEAERARVSEILNESRDAPD 228 LENG E + RR Q + V EILNE+ P+ Sbjct: 794 LENGQIELMLHRRMQHDDIRGVGEILNETVCLPE 827 >At3g13490.1 68416.m01697 tRNA synthetase class II (D, K and N) family protein similar to SP|Q9RHV9 Lysyl-tRNA synthetase (EC 6.1.1.6) (Lysine--tRNA ligase) {Bacillus stearothermophilus}; contains Pfam profile: PF00152 tRNA synthetases class II (D, K and N) Length = 602 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -3 Query: 514 TPAFPCKSRSTRSARGGTAPRGTAPSGRGRGSA 416 +PA C S ++ S+ T + PSGR R SA Sbjct: 40 SPALRCASAASSSSSSATTAETSKPSGRNRRSA 72 >At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 278 Score = 28.3 bits (60), Expect = 4.1 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = -3 Query: 490 RSTRSARGGTAPRGTAPSGRGRGSAVGTPRSPMTRS 383 RS+ ARG + RG GRG G G R P RS Sbjct: 85 RSSHDARGSYSGRGRG--GRGGGDGGGRERGPSRRS 118 Score = 27.9 bits (59), Expect = 5.5 Identities = 24/61 (39%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Frame = -3 Query: 559 SRACAAGSLTFRSRCTPAFPCKSRS-TRSARGGTAPRGTAPSGRGRGSAVGTPRSPMTRS 383 SR+ + G +SR P +SRS +RS +P+ A S R R A T RSP +RS Sbjct: 199 SRSPSRGRSYSKSRSRGRSPSRSRSRSRSRSKSRSPK--AKSLR-RSPAKSTSRSPRSRS 255 Query: 382 R 380 R Sbjct: 256 R 256 >At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 178 Score = 28.3 bits (60), Expect = 4.1 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = -3 Query: 490 RSTRSARGGTAPRGTAPSGRGRGSAVGTPRSPMTRS 383 RS+ ARG + RG GRG G G R P RS Sbjct: 85 RSSHDARGSYSGRGRG--GRGGGDGGGRERGPSRRS 118 >At1g64140.1 68414.m07266 expressed protein similar to putative disease resistance protein GB:CAB40943 GI:4586107 from [Arabidopsis thaliana]; weak similarity to Loricrin (Swiss-Prot:P23490) [Homo sapiens] Length = 646 Score = 28.3 bits (60), Expect = 4.1 Identities = 19/62 (30%), Positives = 24/62 (38%), Gaps = 6/62 (9%) Frame = -3 Query: 292 SHRHGRRCSALSCTD--RQD*FHCQEH----RVTHSGSRRHELSQPPGIVSRPGSPPCRS 131 SH GRRC + CT + C+ H R THSG + P G C Sbjct: 377 SHGGGRRCQSNGCTKGAQGSTMFCKAHGGGKRCTHSGCTKGAEGSTPFCKGHGGGKRCAF 436 Query: 130 RG 125 +G Sbjct: 437 QG 438 >At1g15190.1 68414.m01816 hypothetical protein Length = 248 Score = 28.3 bits (60), Expect = 4.1 Identities = 17/57 (29%), Positives = 30/57 (52%) Frame = -2 Query: 257 MHGSSRLISLSGASRDSFRISETRALSASWNRLSSRLSAMPFSRCSDSEMSPRGSPA 87 +HG + L+ L+ S + + ++ AL+ S L SR S P + ++SP SP+ Sbjct: 159 VHGLADLLPLTAPSSPNRLVEDSTALAKSPWFLGSRFSPAPEPYFAFMDLSPAESPS 215 >At5g09670.2 68418.m01119 loricrin-related contains weak similarity to Loricrin (Swiss-Prot:P23490) [Homo sapiens] Length = 546 Score = 27.5 bits (58), Expect = 7.2 Identities = 18/62 (29%), Positives = 27/62 (43%) Frame = -3 Query: 292 SHRHGRRCSALSCTDRQD*FHCQEHRVTHSGSRRHELSQPPGIVSRPGSPPCRSRGAPTR 113 +H G+RC L CT + + ++H G RR E + +R S C G + Sbjct: 199 THGGGKRCEHLGCTKSAE--GKTDFCISHGGGRRCEFLEGCDKAARGRSGLCIKHGG-GK 255 Query: 112 RC 107 RC Sbjct: 256 RC 257 >At5g09670.1 68418.m01118 loricrin-related contains weak similarity to Loricrin (Swiss-Prot:P23490) [Homo sapiens] Length = 546 Score = 27.5 bits (58), Expect = 7.2 Identities = 18/62 (29%), Positives = 27/62 (43%) Frame = -3 Query: 292 SHRHGRRCSALSCTDRQD*FHCQEHRVTHSGSRRHELSQPPGIVSRPGSPPCRSRGAPTR 113 +H G+RC L CT + + ++H G RR E + +R S C G + Sbjct: 199 THGGGKRCEHLGCTKSAE--GKTDFCISHGGGRRCEFLEGCDKAARGRSGLCIKHGG-GK 255 Query: 112 RC 107 RC Sbjct: 256 RC 257 >At3g15820.1 68416.m02002 phosphatidic acid phosphatase-related / PAP2-related contains Pfam profile PF01569: PAP2 superfamily Length = 301 Score = 27.5 bits (58), Expect = 7.2 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +1 Query: 118 SEHLENGMAESLDERRFQEAERARVSEILN 207 S H+ M SLD RR Q A V +ILN Sbjct: 214 SGHVAGSMIASLDMRRMQRLRLAMVFDILN 243 >At2g32660.1 68415.m03992 disease resistance family protein / LRR family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-4 [Lycopersicon hirsutum] gi|2808683|emb|CAA05268 Length = 589 Score = 27.5 bits (58), Expect = 7.2 Identities = 18/58 (31%), Positives = 25/58 (43%) Frame = +3 Query: 27 PKTSSTPSALTYDDYGAADVGGASPRGHLRVGAPRERHGGEPGRETIPGG*ESSCLRD 200 P+ S L Y D + G P+G +G P+ G G +P E SCLR+ Sbjct: 472 PQELGRLSYLAYIDVSDNQLTGKIPQGTQIIGQPKSSFEGNSGLCGLP--LEESCLRE 527 >At5g64550.1 68418.m08112 loricrin-related contains weak similarity to Loricrin (Swiss-Prot:P23490) [Homo sapiens] Length = 634 Score = 27.1 bits (57), Expect = 9.6 Identities = 11/37 (29%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = +1 Query: 238 NLDDPCMKVHC---SAGRVCEINEHGEAICNCIKECP 339 N D + + C SAGR+ + H +C+ + CP Sbjct: 21 NFGDTALSLKCLGSSAGRLIGSSHHNHKLCSDVSNCP 57 >At5g60930.1 68418.m07643 chromosome-associated kinesin, putative microtubule-associated motor KIF4 , Mus musculus, PIR:A54803 Length = 1294 Score = 27.1 bits (57), Expect = 9.6 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 5/57 (8%) Frame = +1 Query: 91 GLPRGDISESEHLENG----MAESLDERRFQEAERARVSEIL-NESRDAPDNEINLD 246 G ISESE LENG ++ D+ + Q+ +R + +L N D P+ E N D Sbjct: 1100 GKENNSISESEALENGENSQESDEKDKGQQQQVLASRGAMLLQNALADKPEEETNDD 1156 >At5g22010.1 68418.m02561 AAA-type ATPase family protein / BRCT domain-containing protein contains Pfam profiles: PF00533 BRCA1 C Terminus (BRCT) domain, PF00004 ATPase family associated with various cellular activities (AAA) Length = 956 Score = 27.1 bits (57), Expect = 9.6 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -3 Query: 490 RSTRSARGGTAPRGTAPSGRGRGSAVG 410 +S RGG A G + GRGRG G Sbjct: 154 KSAGRGRGGRAAPGASTGGRGRGGGRG 180 >At4g29310.1 68417.m04190 expressed protein Length = 424 Score = 27.1 bits (57), Expect = 9.6 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -3 Query: 511 PAFPCKSRSTRSARGGTAPRGTAPSGRG 428 P F CK S R+ R + P G S RG Sbjct: 186 PVFSCKFSSDRNGRSRSLPSGFTYSSRG 213 >At1g63700.1 68414.m07209 protein kinase, putative contains protein kinase domain, Pfam:PF00069; similar to MEK kinase (MAP3Ka) [Arabidopsis thaliana] gi|4204912|gb|AAD10848 Length = 883 Score = 27.1 bits (57), Expect = 9.6 Identities = 20/57 (35%), Positives = 23/57 (40%) Frame = +3 Query: 3 HLHGRRRGPKTSSTPSALTYDDYGAADVGGASPRGHLRVGAPRERHGGEPGRETIPG 173 H+ GRR P S+P AL+ GGA P H R H G G PG Sbjct: 742 HISGRR-SPSPISSPHALSGSSTPLTGCGGAIPFHHQRQTTVNFLHEG-IGSSRSPG 796 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,751,798 Number of Sequences: 28952 Number of extensions: 278930 Number of successful extensions: 1143 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 1056 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1142 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1197101088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -