BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_B13 (599 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 26 0.28 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 25 0.65 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 25 0.65 AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochr... 25 0.65 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 24 0.85 AF264720-1|AAF75272.1| 126|Tribolium castaneum putative cytochr... 24 1.1 AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory recept... 23 1.5 AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory recept... 23 1.5 AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory recept... 23 2.6 AF263515-1|AAF74207.1| 126|Tribolium castaneum cytochrome P450 ... 23 2.6 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 25.8 bits (54), Expect = 0.28 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +2 Query: 425 RYMQHCISE*LLLLWTEHLVSRNYKERSVL-LGQKLYSAKLREL 553 +Y++ C+ E L L + H +SR E V G KL A + L Sbjct: 362 KYLERCVKEVLRLYPSVHFISRKLGEDLVTHSGHKLAKASIVNL 405 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 24.6 bits (51), Expect = 0.65 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 145 YHVSVVSFYLSSVCYSKFN 89 Y+V+V S YL V YS FN Sbjct: 1008 YYVTVPSMYLLLVIYSVFN 1026 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 24.6 bits (51), Expect = 0.65 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 145 YHVSVVSFYLSSVCYSKFN 89 Y+V+V S YL V YS FN Sbjct: 1008 YYVTVPSMYLLLVIYSVFN 1026 >AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q2 protein. Length = 126 Score = 24.6 bits (51), Expect = 0.65 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +2 Query: 425 RYMQHCISE*LLLLWTEHLVSR 490 +Y++ CI E L L + HL+SR Sbjct: 46 KYLERCIKESLRLYPSVHLISR 67 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 24.2 bits (50), Expect = 0.85 Identities = 14/44 (31%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +2 Query: 425 RYMQHCISE*LLLLWTEHLVSRNYKERSVL-LGQKLYSAKLREL 553 +Y++ C+ E L L + H +SR E V G KL + L Sbjct: 362 KYLERCVKEVLRLYPSVHFISRKLGEDLVTHSGHKLAKGSIVNL 405 >AF264720-1|AAF75272.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q1 protein. Length = 126 Score = 23.8 bits (49), Expect = 1.1 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +2 Query: 425 RYMQHCISE*LLLLWTEHLVSRNYKERSVLLG 520 +Y++ CI E L L + H +SR + + G Sbjct: 46 KYLERCIKETLRLYPSVHFISRTLGQDLITTG 77 >AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory receptor candidate 55 protein. Length = 402 Score = 23.4 bits (48), Expect = 1.5 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = -3 Query: 315 FTCFRFICCSINLHNEFRIIFETLEDHFSEMKSISGYL*LSDN 187 F+ ++F+ + L + F I T+ FS+ K +SDN Sbjct: 187 FSKYQFVVLVLQLQHRFGKINRTMRSFFSDNKQDDKIPQISDN 229 >AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory receptor candidate 11 protein. Length = 344 Score = 23.4 bits (48), Expect = 1.5 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = -3 Query: 315 FTCFRFICCSINLHNEFRIIFETLEDHFSEMKSISGYL*LSDN 187 F+ ++F+ + L + F I T+ FS+ K +SDN Sbjct: 187 FSKYQFVVLVLQLQHRFGKINRTMRSFFSDNKQDDKIPQISDN 229 >AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory receptor candidate 24 protein. Length = 384 Score = 22.6 bits (46), Expect = 2.6 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = -1 Query: 557 SVALSVWQNIIFGPITLNVPCNSWRPSVL 471 S+ + ++Q+ IFG +T + +RPS L Sbjct: 14 SIRILLFQSRIFGLVTFTPDRSKFRPSSL 42 >AF263515-1|AAF74207.1| 126|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 126 Score = 22.6 bits (46), Expect = 2.6 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +2 Query: 425 RYMQHCISE*LLLLWTEHLVSRNYKERSV-LLGQKLYSAKLREL 553 +YM+ I E L L + H +SR E V G KL + +L Sbjct: 46 KYMERVIKEVLRLYPSVHYISRELGEDMVTTTGYKLRKGTILQL 89 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,287 Number of Sequences: 336 Number of extensions: 2855 Number of successful extensions: 13 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15143945 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -