BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_B11 (656 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 23 1.7 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 8.9 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 23.4 bits (48), Expect = 1.7 Identities = 11/35 (31%), Positives = 15/35 (42%) Frame = -1 Query: 647 CTRIGPGVLQHNICSTRMFIEECGDIKDSIVNNDP 543 CT PGV ++CS+ F E+ I P Sbjct: 101 CTPREPGVAGGDVCSSESFNEDIAVFSKQIRQEKP 135 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.0 bits (42), Expect = 8.9 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = -1 Query: 617 HNICSTRMFIEECGDIKDSIVNNDPAIV 534 H CST + + G++ I ND I+ Sbjct: 651 HVCCSTIHEVSKAGELIHKIETNDHEII 678 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,501 Number of Sequences: 336 Number of extensions: 2906 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16969115 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -