BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_B09 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g60140.1 68416.m06715 glycosyl hydrolase family 1 protein con... 33 0.086 At4g22970.1 68417.m03315 peptidase C50 family protein contains P... 30 1.1 At3g07050.1 68416.m00837 GTP-binding family protein contains Pfa... 29 2.5 At3g10430.1 68416.m01251 F-box family protein contains F-box dom... 28 3.2 At2g40460.1 68415.m04993 proton-dependent oligopeptide transport... 28 3.2 At1g25540.1 68414.m03171 phytochrome and flowering time regulato... 28 3.2 At2g27570.1 68415.m03340 sulfotransferase family protein similar... 27 5.7 At5g60970.1 68418.m07648 TCP family transcription factor, putati... 27 7.5 At5g14950.1 68418.m01754 glycosyl hydrolase family 38 protein si... 27 7.5 At2g44460.1 68415.m05528 glycosyl hydrolase family 1 protein con... 27 7.5 At3g55220.1 68416.m06133 splicing factor, putative contains CPSF... 27 9.9 At3g55200.1 68416.m06131 splicing factor, putative contains CPSF... 27 9.9 >At3g60140.1 68416.m06715 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; similar to Cyanogenic Beta-Glucosidase (GI:1311386)(pdb:1CBG) [Trifolium Repens]; identical beta-glucosidase GI:10834547 Length = 577 Score = 33.5 bits (73), Expect = 0.086 Identities = 13/42 (30%), Positives = 26/42 (61%) Frame = +1 Query: 136 IRYKRQIENNANLFIDKNGWNKSQDGNRPEWIPIQNGYRIQY 261 + Y ++ NN ++I +NG N + DG +P +++ +RI+Y Sbjct: 394 LNYIKERYNNMPVYIKENGINDNDDGTKPREEIVKDTFRIEY 435 >At4g22970.1 68417.m03315 peptidase C50 family protein contains Pfam PF03568: Peptidase family C50 Length = 1773 Score = 29.9 bits (64), Expect = 1.1 Identities = 23/76 (30%), Positives = 35/76 (46%) Frame = +2 Query: 245 VTEFNTLWTTIIIL*PSFFLIKCSSQTKHRYQVKGKHQLLALVEHHDKQLRNARRIAFQH 424 V++F + +I + L CSS + + K Q L L E K+L+NA+ I + Sbjct: 911 VSQFGVKFAGFLIPFVNKLLDLCSSSLISQGNLYHKKQCLDLAE---KELQNAKEILIAN 967 Query: 425 QNTTPCVVAIIKLTKT 472 Q CV +KL T Sbjct: 968 QRDFSCVKCKLKLEVT 983 >At3g07050.1 68416.m00837 GTP-binding family protein contains Pfam domain, PF01926: GTPase of unknown function Length = 582 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/44 (31%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = +2 Query: 302 LIKCSSQTKH-RYQVKGKHQLLALV-EHHDKQLRNARRIAFQHQ 427 ++K S ++K R +K KH++L V EHH K+ ++A+++ + Sbjct: 1 MVKRSKKSKSKRVTLKQKHKVLKKVKEHHKKKAKDAKKLGLHRK 44 >At3g10430.1 68416.m01251 F-box family protein contains F-box domain Pfam:PF00646 Length = 370 Score = 28.3 bits (60), Expect = 3.2 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -2 Query: 440 TGLYSGVEMQFSAHFSIVCRDVPPVLGVDVCP*PG 336 T S + FS +FS+ D+P +D+ P PG Sbjct: 266 TNKLSDEVVSFSRYFSVTLPDIPLFRSIDILPLPG 300 >At2g40460.1 68415.m04993 proton-dependent oligopeptide transport (POT) family protein contains Pfam profile: PF00854 POT family Length = 583 Score = 28.3 bits (60), Expect = 3.2 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +2 Query: 329 HRYQVKGKHQLLALVEHHDKQLRNARRIAFQHQNTTPCVVAIIKLTK 469 H Y+ GKHQ+ HH R + A + + PC V +++ K Sbjct: 277 HYYKSNGKHQV-----HHTPVFRFLDKAAIKTSSRVPCTVTKVEVAK 318 >At1g25540.1 68414.m03171 phytochrome and flowering time regulatory protein (PFT1) PMID: 12815435 Length = 836 Score = 28.3 bits (60), Expect = 3.2 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +2 Query: 320 QTKHRYQVKGKHQLLALVEHHDKQLRNARRIAFQHQNT 433 Q +H+ Q + +HQL L +HH +Q + ++ QHQ T Sbjct: 721 QQQHQQQQQQQHQLSQL-QHHQQQQQQQQQQQQQHQLT 757 >At2g27570.1 68415.m03340 sulfotransferase family protein similar to steroid sulfotransferase from [Brassica napus] GI:3420008, GI:3420006; contains Pfam profile PF00685: Sulfotransferase domain Length = 273 Score = 27.5 bits (58), Expect = 5.7 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -2 Query: 230 IHSGRFPS*DLFHPFLSINKFALFS 156 +H + PS D HP LS N LFS Sbjct: 88 VHRSKHPSHDHHHPLLSNNPHVLFS 112 >At5g60970.1 68418.m07648 TCP family transcription factor, putative putative basic helix-loop-helix DNA binding protein TCP2, Arabidopsis thaliana, EMBL:AF072691 Length = 360 Score = 27.1 bits (57), Expect = 7.5 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = +1 Query: 178 IDKNGWNKSQDGNRPEWIPIQNGYRIQYPLDNNYN 282 +DK W K+ + + + ++ Q+PL N YN Sbjct: 192 LDKGKWIKNDENSNQDHQGFNTNHQQQFPLTNPYN 226 >At5g14950.1 68418.m01754 glycosyl hydrolase family 38 protein similar to alpha-mannosidase II SP:P27046 from [Mus musculus] Length = 1173 Score = 27.1 bits (57), Expect = 7.5 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +1 Query: 136 IRYKRQIENNANLFIDKNGWNKSQDGNRPEWIPIQNGYRIQYPL 267 +RYK ++N + D NG+ S+ + IP+Q Y YP+ Sbjct: 883 VRYKTDVDNKKVFYSDLNGFQMSRRETYDK-IPLQGNY---YPM 922 >At2g44460.1 68415.m05528 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; similar to beta-glucosidase 1 (GI:12043529) [Arabidopsis thaliana] Length = 582 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = +1 Query: 136 IRYKRQIENNANLFIDKNGWNKSQDGNRPEWIPIQNGYRIQYPLDN 273 + Y + NN ++I +NG N DG + + + +RI Y D+ Sbjct: 396 LNYIKDKYNNPIVYIKENGINDYDDGTKSREEILNDTFRISYHEDH 441 >At3g55220.1 68416.m06133 splicing factor, putative contains CPSF A subunit region (PF03178); contains weak WD-40 repeat (PF00400); similar to Splicing factor 3B subunit 3 (SF3b130)/spliceosomal protein/Splicing factor 3B subunit 3 (SAP 130)(KIAA0017)(SP:Q15393) Homo sapiens, EMBL:HSAJ1443_1 Length = 1214 Score = 26.6 bits (56), Expect = 9.9 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 Query: 427 EYNPVCGSDHQTYKN 471 EY P+CG DH Y++ Sbjct: 1149 EYPPLCGRDHMAYRS 1163 >At3g55200.1 68416.m06131 splicing factor, putative contains CPSF A subunit region (PF03178); contains weak WD-40 repeat (PF00400); similar to Splicing factor 3B subunit 3 (SF3b130)/spliceosomal protein/Splicing factor 3B subunit 3 (SAP 130)(KIAA0017)(SP:Q15393) Homo sapiens, EMBL:HSAJ1443_1 Length = 1214 Score = 26.6 bits (56), Expect = 9.9 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 Query: 427 EYNPVCGSDHQTYKN 471 EY P+CG DH Y++ Sbjct: 1149 EYPPLCGRDHMAYRS 1163 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,950,394 Number of Sequences: 28952 Number of extensions: 251527 Number of successful extensions: 578 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 561 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 578 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -