BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_B07 (607 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40067| Best HMM Match : Nop17p (HMM E-Value=1.5e-13) 29 3.9 SB_56074| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 >SB_40067| Best HMM Match : Nop17p (HMM E-Value=1.5e-13) Length = 287 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = -1 Query: 208 PPLGVFPKNSPKKSGSKLIFTLELPDVVACSEHDIKIT 95 P V KNS + +L+ T+ELP V++ ++ D++I+ Sbjct: 246 PVYNVAVKNSSEGRPRRLVVTVELPGVLSVADCDLEIS 283 >SB_56074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 387 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = -3 Query: 98 HGHHYKL*THHSAMYFKIFF*YY-HKTCVSLR 6 HGH YK+ H+ +K+F Y+ H+ V R Sbjct: 284 HGHQYKVFAHYHGHQYKVFARYHGHQYSVRAR 315 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,939,730 Number of Sequences: 59808 Number of extensions: 227499 Number of successful extensions: 509 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 451 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 508 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1475788250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -