BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_B07 (607 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 24 3.3 AF020851-1|AAC31864.1| 214|Anopheles gambiae unknown protein. 24 3.3 AF020850-1|AAC31863.1| 214|Anopheles gambiae unknown protein. 24 3.3 AF020849-1|AAC31862.1| 214|Anopheles gambiae unknown protein. 24 3.3 AF515524-1|AAM61891.1| 218|Anopheles gambiae glutathione S-tran... 24 4.4 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 23 7.7 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 24.2 bits (50), Expect = 3.3 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 212 LSTIGSFPEKFAQEIWIKIDIYFRAARC 129 L + +FP +F E W + RAA+C Sbjct: 433 LPVLKNFPTRFIHEPWNASESVQRAAKC 460 >AF020851-1|AAC31864.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -1 Query: 211 CPPLGVFPKNSPKKSGSK 158 C PLG+ P N S SK Sbjct: 126 CLPLGILPSNQRSSSSSK 143 >AF020850-1|AAC31863.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -1 Query: 211 CPPLGVFPKNSPKKSGSK 158 C PLG+ P N S SK Sbjct: 126 CLPLGILPSNQRSSSSSK 143 >AF020849-1|AAC31862.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -1 Query: 211 CPPLGVFPKNSPKKSGSK 158 C PLG+ P N S SK Sbjct: 126 CLPLGILPSNQRSSSSSK 143 >AF515524-1|AAM61891.1| 218|Anopheles gambiae glutathione S-transferase u3 protein. Length = 218 Score = 23.8 bits (49), Expect = 4.4 Identities = 10/21 (47%), Positives = 13/21 (61%), Gaps = 3/21 (14%) Frame = +2 Query: 524 YQPGCVLYSTEHDNR---NHK 577 Y+PGC LY +E R NH+ Sbjct: 79 YKPGCTLYPSEPKKRGLINHR 99 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 23.0 bits (47), Expect = 7.7 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +3 Query: 444 NRLIYDNYAAMTGASLIGIRFNSEQCDTSLDVC 542 NR+ +DN + ++IG FN SL C Sbjct: 324 NRMFFDNIGTILLMAVIGTIFNIATIGGSLWAC 356 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 469,094 Number of Sequences: 2352 Number of extensions: 8635 Number of successful extensions: 76 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 70 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 76 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58870980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -