BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_B05 (415 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8395| Best HMM Match : Arm (HMM E-Value=2.3) 29 2.0 SB_621| Best HMM Match : SNF2_N (HMM E-Value=0) 27 6.1 >SB_8395| Best HMM Match : Arm (HMM E-Value=2.3) Length = 412 Score = 28.7 bits (61), Expect = 2.0 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -3 Query: 398 VTGIFLQFGMQFIWSLFQVHFICYVQCNTWYRLQIGC 288 +TG LQ M S+ Q ++ V C WY L++ C Sbjct: 210 LTGGILQ-AMVLTRSILQAMYLLDVSCRPWYLLEVSC 245 >SB_621| Best HMM Match : SNF2_N (HMM E-Value=0) Length = 1432 Score = 27.1 bits (57), Expect = 6.1 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = -1 Query: 178 YSAESGEDTTF*LLSSSFKNLAENLATADEIAL 80 ++AE ED F LLS+ L NLATAD + + Sbjct: 466 FNAEGSEDFCF-LLSTRAGGLGINLATADTVII 497 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,417,229 Number of Sequences: 59808 Number of extensions: 161707 Number of successful extensions: 318 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 303 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 318 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 764823134 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -