BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_A24 (485 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP23A10.16 |sdh4|tim18|TIM22 inner membrane protein import com... 36 0.002 SPBC354.13 |rga6||GTPase activating protein Rga6|Schizosaccharom... 27 1.5 SPBC28E12.03 |rga4||GTPase activating protein Rga4|Schizosacchar... 26 3.5 SPAC11G7.01 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 25 4.6 SPAPB17E12.13 |rpl1802|rpl18-2|60S ribosomal protein L18|Schizos... 25 6.1 SPCC285.09c |cgs2|pde1|cAMP-specific phosphodiesterase Cgs2|Schi... 25 6.1 SPBC11C11.07 |rpl1801|rpl18-1, rpl18|60S ribosomal protein L18|S... 25 6.1 >SPBP23A10.16 |sdh4|tim18|TIM22 inner membrane protein import complex anchor subunit Tim18|Schizosaccharomyces pombe|chr 2|||Manual Length = 186 Score = 36.3 bits (80), Expect = 0.002 Identities = 20/68 (29%), Positives = 36/68 (52%) Frame = +1 Query: 1 LVAILITAHSFWGLEAIAVDYVRASMFGPVIPKIAIGLVYLVSIATLAGLFYIISHDIGL 180 L LIT H+ G E+ +DY A F + P + ++ ++ TL G++ ++DIGL Sbjct: 119 LACTLIT-HAHLGFESCVIDYFPARRFKKLSP-LMHWILRGCTVLTLIGVYEFNTNDIGL 176 Query: 181 ANTVRQFW 204 +++ W Sbjct: 177 TEGIKKLW 184 >SPBC354.13 |rga6||GTPase activating protein Rga6|Schizosaccharomyces pombe|chr 2|||Manual Length = 733 Score = 27.1 bits (57), Expect = 1.5 Identities = 20/70 (28%), Positives = 30/70 (42%) Frame = +3 Query: 6 RDSHHRA*LLGSRGDCRRLRTGEYVRSRHTQNCDRLSLSRIHSNPRRSVLHH*PRHRSCE 185 +DS R+ GS R + Y R + R SL+ P R+ H +H + Sbjct: 239 QDSPKRSPSKGSWSSILRRPSLTYSPKRQSTGLHRRSLTNYFKFPHRNA--H--QHNAIA 294 Query: 186 HRPTVLGDPL 215 H P+V G P+ Sbjct: 295 HNPSVFGKPI 304 >SPBC28E12.03 |rga4||GTPase activating protein Rga4|Schizosaccharomyces pombe|chr 2|||Manual Length = 933 Score = 25.8 bits (54), Expect = 3.5 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -1 Query: 272 CEPNYNHSTVIRIYDFWLS 216 CEP YN S+++R D + S Sbjct: 453 CEPEYNRSSLVRASDVFTS 471 >SPAC11G7.01 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 536 Score = 25.4 bits (53), Expect = 4.6 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +2 Query: 155 TSLATTSVLRTPSDSSGRSAPTTRSHKFV*PSNDCSLV 268 TSL++++ P+ SS +A T+ S V PS+ S++ Sbjct: 12 TSLSSSASSSIPASSSSAAASTSLSSSSVIPSSSSSML 49 >SPAPB17E12.13 |rpl1802|rpl18-2|60S ribosomal protein L18|Schizosaccharomyces pombe|chr 1|||Manual Length = 187 Score = 25.0 bits (52), Expect = 6.1 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 111 AYRNFGYDGTEHTRPYV 61 AYR+FG+ +H PYV Sbjct: 150 AYRHFGFGPHKHKAPYV 166 >SPCC285.09c |cgs2|pde1|cAMP-specific phosphodiesterase Cgs2|Schizosaccharomyces pombe|chr 3|||Manual Length = 346 Score = 25.0 bits (52), Expect = 6.1 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = +1 Query: 64 VRASMFGPVIPKIAIGLVYLV 126 + ++MFGP P+ +GL Y++ Sbjct: 125 INSAMFGPQNPRTIVGLNYVI 145 >SPBC11C11.07 |rpl1801|rpl18-1, rpl18|60S ribosomal protein L18|Schizosaccharomyces pombe|chr 2|||Manual Length = 187 Score = 25.0 bits (52), Expect = 6.1 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 111 AYRNFGYDGTEHTRPYV 61 AYR+FG+ +H PYV Sbjct: 150 AYRHFGFGPHKHKAPYV 166 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,980,406 Number of Sequences: 5004 Number of extensions: 37874 Number of successful extensions: 88 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 87 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 88 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 188065158 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -