BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_A24 (485 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 23 1.3 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 4.0 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 4.0 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 5.3 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 23.4 bits (48), Expect = 1.3 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -3 Query: 93 YDGTEHTRPYVIYGNRL*TPEAMRGDENRD 4 YD T PY +Y + + +ENRD Sbjct: 328 YDNTPRDFPYYMYSREQYSQSHLISNENRD 357 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 4.0 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -2 Query: 274 SVNQTTIIRRLYEFMTSGC 218 S N TT++ RL+ + +GC Sbjct: 1509 SPNSTTLVLRLHVWPDNGC 1527 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 4.0 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -2 Query: 274 SVNQTTIIRRLYEFMTSGC 218 S N TT++ RL+ + +GC Sbjct: 1505 SPNSTTLVLRLHVWPDNGC 1523 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.4 bits (43), Expect = 5.3 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -2 Query: 82 RTYSPVRNLRQSPLDPRSYA 23 R ++P+ L +PL PR Y+ Sbjct: 881 RPFAPLLLLHLTPLQPRFYS 900 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,035 Number of Sequences: 438 Number of extensions: 3181 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13297932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -