BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_A23 (394 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 26 0.18 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 23 1.3 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 1.7 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 1.7 AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 22 2.9 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 3.8 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 21 3.8 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 21 3.8 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 21 3.8 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 3.8 AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 21 3.8 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 3.8 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 21 6.7 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 21 6.7 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 21 6.7 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 21 6.7 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 21 6.7 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 6.7 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 20 8.8 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 20 8.8 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 20 8.8 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 20 8.8 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 25.8 bits (54), Expect = 0.18 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +3 Query: 195 YYPCCDECY 221 YYPCCDE Y Sbjct: 214 YYPCCDEPY 222 Score = 20.2 bits (40), Expect = 8.8 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = +2 Query: 104 WEYDSVQIQKKPCTQ 148 W YD +QI K Q Sbjct: 166 WTYDGIQIDLKHINQ 180 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 23.0 bits (47), Expect = 1.3 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 195 YYPCCDECY 221 YYPCC E Y Sbjct: 228 YYPCCTEPY 236 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.6 bits (46), Expect = 1.7 Identities = 8/21 (38%), Positives = 11/21 (52%), Gaps = 2/21 (9%) Frame = +3 Query: 189 LAYYPCC--DECYVLPHPLQC 245 + YYPCC C+ + P C Sbjct: 483 IGYYPCCWWKICWTITTPAIC 503 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.6 bits (46), Expect = 1.7 Identities = 8/21 (38%), Positives = 11/21 (52%), Gaps = 2/21 (9%) Frame = +3 Query: 189 LAYYPCC--DECYVLPHPLQC 245 + YYPCC C+ + P C Sbjct: 536 IGYYPCCWWKICWTITTPAIC 556 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 21.8 bits (44), Expect = 2.9 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +1 Query: 247 RPCSPVPHT*NLGFPVLIPKDRLGYCDPGPNTGS 348 RPC+ V +IP++ G+ D GP T S Sbjct: 116 RPCTSVEEY------AIIPQEIAGFADEGPFTTS 143 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.4 bits (43), Expect = 3.8 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -1 Query: 172 LGLLGQEWLGARFFLNLDTVVFPNQGKGWESCLRD 68 L LL ++ LG + N+ V P+ + W + LRD Sbjct: 380 LDLLVRKVLGFGYESNVKYQVVPSALQMWSTSLRD 414 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.4 bits (43), Expect = 3.8 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = +3 Query: 195 YYPCCDECYV 224 +Y CCDE Y+ Sbjct: 223 FYTCCDEPYL 232 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.4 bits (43), Expect = 3.8 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = +3 Query: 195 YYPCCDECYV 224 +Y CCDE Y+ Sbjct: 223 FYTCCDEPYL 232 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.4 bits (43), Expect = 3.8 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = +3 Query: 195 YYPCCDECYV 224 +Y CCDE Y+ Sbjct: 219 FYTCCDEPYL 228 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.4 bits (43), Expect = 3.8 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -1 Query: 172 LGLLGQEWLGARFFLNLDTVVFPNQGKGWESCLRD 68 L LL ++ LG + N+ V P+ + W + LRD Sbjct: 380 LDLLVRKVLGFGYESNVKYQVVPSALQMWSTSLRD 414 >AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. Length = 226 Score = 21.4 bits (43), Expect = 3.8 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -1 Query: 172 LGLLGQEWLGARFFLNLDTVVFPNQGKGWESCLRD 68 L LL ++ LG + N+ V P+ + W + LRD Sbjct: 6 LDLLVRKVLGFGYESNVKYQVVPSALQMWSTSLRD 40 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.4 bits (43), Expect = 3.8 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = +2 Query: 77 TAFPPLPLVWEYDSVQIQ 130 T PP PLVW + ++ Sbjct: 335 TGTPPPPLVWRRNGADLE 352 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 20.6 bits (41), Expect = 6.7 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +3 Query: 84 SHPFPWFGNTTVSRFRKNLAP 146 S PFP F RFR +L P Sbjct: 150 STPFPRFIPPNAYRFRPSLNP 170 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 20.6 bits (41), Expect = 6.7 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +3 Query: 84 SHPFPWFGNTTVSRFRKNLAP 146 S PFP F RFR +L P Sbjct: 150 STPFPRFIPPNAYRFRPSLNP 170 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 20.6 bits (41), Expect = 6.7 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +3 Query: 84 SHPFPWFGNTTVSRFRKNLAP 146 S PFP F RFR +L P Sbjct: 150 STPFPRFIPPNAYRFRPSLNP 170 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 20.6 bits (41), Expect = 6.7 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +3 Query: 84 SHPFPWFGNTTVSRFRKNLAP 146 S PFP F + RFR L P Sbjct: 155 STPFPRFISPNAYRFRPPLNP 175 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 20.6 bits (41), Expect = 6.7 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = +3 Query: 195 YYPCCDECYV 224 YY CC E Y+ Sbjct: 210 YYNCCPEPYI 219 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 20.6 bits (41), Expect = 6.7 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +3 Query: 84 SHPFPWFGNTTVSRFRKNLAP 146 S PFP F RFR +L P Sbjct: 383 STPFPRFIPPNAYRFRPSLNP 403 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 20.2 bits (40), Expect = 8.8 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +2 Query: 101 VWEYDSVQIQK 133 +W+YDS I K Sbjct: 318 IWDYDSTYIPK 328 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 20.2 bits (40), Expect = 8.8 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = +3 Query: 192 AYYPCCDECY 221 A+Y CC+E Y Sbjct: 214 AFYICCEEPY 223 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 20.2 bits (40), Expect = 8.8 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 90 PFPWFGNTTVSRFRKNLAP 146 PFP F V RFR L P Sbjct: 375 PFPRFIPPNVYRFRPPLNP 393 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 20.2 bits (40), Expect = 8.8 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 229 LTPYNVRPCSPVP 267 LTP + P SPVP Sbjct: 435 LTPPSSNPVSPVP 447 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,743 Number of Sequences: 438 Number of extensions: 3807 Number of successful extensions: 23 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9638226 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -