BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_A22 (416 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1028 + 30230224-30231274,30231500-30231609,30232144-302321... 34 0.053 08_02_0067 - 11863092-11863104,11863432-11863547,11863610-118639... 29 1.5 05_03_0359 - 12929240-12929376,12931379-12933497,12933594-129337... 28 2.6 04_04_0071 - 22513684-22513697,22514052-22514328,22514417-225146... 27 4.6 12_01_0282 - 2088302-2089081 27 6.0 10_08_0740 + 20225351-20225683,20225750-20226022,20226423-202265... 27 6.0 08_01_0233 + 1876940-1877509,1907940-1908195,1908290-1908589,190... 27 6.0 04_04_0891 + 29130494-29130904,29131043-29131102,29131203-291314... 27 6.0 04_04_0376 + 24809804-24809888,24810575-24810703,24810797-248110... 27 6.0 03_01_0176 - 1416316-1416405,1416705-1416761,1416885-1417010,141... 27 6.0 01_06_1652 + 38918159-38918377,38918502-38919428 27 6.0 04_04_0867 + 28865857-28866657,28866778-28867113,28867248-288674... 27 8.0 >04_04_1028 + 30230224-30231274,30231500-30231609,30232144-30232170, 30233107-30234252 Length = 777 Score = 33.9 bits (74), Expect = 0.053 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = -1 Query: 107 PGTGSADAYSVPFIKLQRSITFNFNNTSAS 18 PGT DAY +P Q +TF FN TSAS Sbjct: 200 PGTACCDAYGMPLDDAQE-VTFEFNKTSAS 228 >08_02_0067 - 11863092-11863104,11863432-11863547,11863610-11863950, 11864978-11865331,11866055-11866150,11866812-11866980, 11867541-11867618,11867745-11867926,11868010-11868094, 11868545-11868648,11869510-11869590,11870123-11870240, 11871299-11871430,11871635-11871788,11871838-11871917 Length = 700 Score = 29.1 bits (62), Expect = 1.5 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -2 Query: 295 FSSLPSISMLIHPTKPDAPARSIGSWSKSGTPP 197 FSSL S ++HP D R+ GS S +GT P Sbjct: 405 FSSLTSHRSVLHPRDIDIHVRTSGSVSLTGTNP 437 >05_03_0359 - 12929240-12929376,12931379-12933497,12933594-12933773, 12933905-12934118,12934199-12934551,12934642-12934864, 12934953-12935230,12935456-12935725,12935817-12935939, 12936025-12936102,12936351-12936527,12936597-12936686, 12937010-12937120,12937397-12937585,12937667-12937858, 12937990-12938076,12938153-12938257,12938340-12938396, 12938471-12938545,12938647-12938763,12938876-12939000, 12939082-12939121,12939241-12939291,12939382-12939569, 12939808-12939901,12939976-12940149,12940242-12940337, 12940597-12940689,12940794-12940955,12941034-12941240, 12941356-12941728,12942379-12942436,12943096-12943171, 12943874-12943941,12944321-12944642 Length = 2433 Score = 28.3 bits (60), Expect = 2.6 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = -1 Query: 266 YTSDKTRCSSEVNWKLVKVRNTTNVKRLIQF*YRPLIR--*LSNKWST 129 Y K S + W + +RNT N K L + +R L+R +SNK+S+ Sbjct: 1441 YNEMKYTPSRDRQWHIYTLRNTENPKMLHRVFFRTLVRQPSVSNKFSS 1488 >04_04_0071 - 22513684-22513697,22514052-22514328,22514417-22514659, 22515119-22515157 Length = 190 Score = 27.5 bits (58), Expect = 4.6 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +3 Query: 33 VKVKGDRPLQLNEWHTIRISRTGSRLTMDVDNSGPFIAESPD 158 V +KG RP+Q++ H + R+ ++N G F++ PD Sbjct: 152 VLLKGGRPIQMSTDHDPNVERSA------IENRGGFVSNMPD 187 >12_01_0282 - 2088302-2089081 Length = 259 Score = 27.1 bits (57), Expect = 6.0 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -2 Query: 133 PLLSTSIVNLEPVLLMRIVCHSLSCKGRSPLTLTIPAP 20 PLL+ S+ NL + R++ S RSP+ L P+P Sbjct: 70 PLLARSLSNLRLIPGRRLLPSSAPVISRSPVLLLFPSP 107 >10_08_0740 + 20225351-20225683,20225750-20226022,20226423-20226548, 20226676-20226732,20226994-20227083 Length = 292 Score = 27.1 bits (57), Expect = 6.0 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = +2 Query: 239 WSIWFCRMYKHADTWQRREEHH 304 W+ W R HA W E HH Sbjct: 139 WARWAHRALWHASLWHMHESHH 160 >08_01_0233 + 1876940-1877509,1907940-1908195,1908290-1908589, 1908777-1908939,1908958-1908994,1910122-1910742 Length = 648 Score = 27.1 bits (57), Expect = 6.0 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = +3 Query: 234 LAGASGFVGCISMLILGNEEKNIMALALEKENVQNCFTCAPNLCLNNGV 380 L GAS F G ++ GN+E I+ E + + T ++ LN G+ Sbjct: 527 LGGASVFTGRVTAWTTGNDEDEIVLYDSEVADTRTEITADGSVQLNRGL 575 >04_04_0891 + 29130494-29130904,29131043-29131102,29131203-29131409, 29131520-29131645,29131767-29131823,29131946-29132014 Length = 309 Score = 27.1 bits (57), Expect = 6.0 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = +2 Query: 239 WSIWFCRMYKHADTWQRREEHH 304 W+ W R HA W E HH Sbjct: 163 WAQWAHRSLWHASLWHMHESHH 184 >04_04_0376 + 24809804-24809888,24810575-24810703,24810797-24811020, 24811398-24811607,24811697-24811789,24811899-24811937, 24812041-24812130,24812214-24812316,24812388-24812468, 24812929-24813005,24813156-24813236,24814165-24814256, 24814536-24814662 Length = 476 Score = 27.1 bits (57), Expect = 6.0 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 153 PDQWTVLELNQPLYIGGVPD 212 PD W L++N +Y+ G+PD Sbjct: 222 PDSWFDLKVNTHVYVTGLPD 241 >03_01_0176 - 1416316-1416405,1416705-1416761,1416885-1417010, 1417944-1418150,1418235-1418714 Length = 319 Score = 27.1 bits (57), Expect = 6.0 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = +2 Query: 239 WSIWFCRMYKHADTWQRREEHH 304 W+ W R HA W E HH Sbjct: 166 WARWAHRALWHASLWHMHESHH 187 >01_06_1652 + 38918159-38918377,38918502-38919428 Length = 381 Score = 27.1 bits (57), Expect = 6.0 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -2 Query: 121 TSIVNLEPVLLMRIVCHSLSCKGRSPLTLTIPAPVS 14 +S++N P+LL+ +VC LS RS + + P S Sbjct: 8 SSVINGAPLLLVVVVCFGLSPVARSQSSDSCSTPAS 43 >04_04_0867 + 28865857-28866657,28866778-28867113,28867248-28867451, 28867567-28867746 Length = 506 Score = 26.6 bits (56), Expect = 8.0 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +3 Query: 120 VDNSGPFIAESPDQWTVLELNQPLYIGGVPDFDQLPI 230 +D+SG F+AESP ++T + + +G + Q+ I Sbjct: 429 LDDSGMFVAESPFKFTAFQAGPRICLGKEFAYRQMKI 465 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,227,683 Number of Sequences: 37544 Number of extensions: 223658 Number of successful extensions: 603 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 596 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 602 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 754585524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -