BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_A22 (416 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) 66 8e-12 SB_46304| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 64 6e-11 SB_32282| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 54 5e-08 SB_55345| Best HMM Match : Laminin_G_2 (HMM E-Value=2e-31) 54 6e-08 SB_7343| Best HMM Match : EGF (HMM E-Value=0) 50 1e-06 SB_25361| Best HMM Match : Cadherin (HMM E-Value=0) 45 2e-05 SB_42841| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_35857| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 4e-04 SB_9507| Best HMM Match : Cadherin (HMM E-Value=0) 41 4e-04 SB_7492| Best HMM Match : Laminin_G_2 (HMM E-Value=0.0025) 40 0.001 SB_13148| Best HMM Match : Laminin_G_2 (HMM E-Value=6.4e-27) 39 0.002 SB_47423| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.006 SB_11569| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.010 SB_39328| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 35 0.023 SB_17959| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.023 SB_25851| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 34 0.041 SB_32719| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.072 SB_30923| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.095 SB_22957| Best HMM Match : EGF (HMM E-Value=7e-39) 33 0.12 SB_2152| Best HMM Match : EGF (HMM E-Value=0) 33 0.12 SB_35194| Best HMM Match : EGF_2 (HMM E-Value=0) 32 0.17 SB_41795| Best HMM Match : EGF (HMM E-Value=8.7e-11) 32 0.22 SB_38062| Best HMM Match : EGF (HMM E-Value=1.8e-07) 32 0.22 SB_786| Best HMM Match : EGF (HMM E-Value=0) 32 0.22 SB_3456| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.22 SB_50262| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.29 SB_33543| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.29 SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.38 SB_52794| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.38 SB_40275| Best HMM Match : Cadherin (HMM E-Value=0) 31 0.50 SB_8425| Best HMM Match : EGF (HMM E-Value=0) 30 0.67 SB_3457| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.67 SB_4760| Best HMM Match : EGF (HMM E-Value=8.29989e-42) 30 0.88 SB_20112| Best HMM Match : EGF (HMM E-Value=0) 29 1.2 SB_7108| Best HMM Match : Pili_assembly_C (HMM E-Value=0.83) 29 1.2 SB_47131| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_31961| Best HMM Match : EGF (HMM E-Value=0) 29 1.5 SB_16935| Best HMM Match : Cadherin (HMM E-Value=0) 29 1.5 SB_58558| Best HMM Match : EGF (HMM E-Value=0) 29 2.0 SB_19005| Best HMM Match : EGF (HMM E-Value=1.4e-20) 29 2.0 SB_13146| Best HMM Match : Laminin_G_2 (HMM E-Value=1.5e-25) 29 2.0 SB_6077| Best HMM Match : EGF (HMM E-Value=0) 28 2.7 SB_32721| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_32588| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_25220| Best HMM Match : Ank (HMM E-Value=6.2e-11) 28 3.6 SB_54456| Best HMM Match : EGF (HMM E-Value=2.3e-31) 28 3.6 SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_29786| Best HMM Match : I-set (HMM E-Value=0) 27 4.7 SB_27922| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.7 SB_5870| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.7 SB_57231| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.7 SB_45116| Best HMM Match : EGF (HMM E-Value=0) 27 4.7 SB_33848| Best HMM Match : RasGEF_N (HMM E-Value=2.3e-13) 27 4.7 SB_33579| Best HMM Match : Laminin_G_2 (HMM E-Value=3.2e-34) 27 4.7 SB_28495| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_59261| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_40186| Best HMM Match : Extensin_2 (HMM E-Value=0.0036) 27 6.2 SB_1891| Best HMM Match : EGF (HMM E-Value=6.5e-15) 27 6.2 SB_47369| Best HMM Match : EGF (HMM E-Value=0.49) 27 8.2 SB_44902| Best HMM Match : EGF (HMM E-Value=9.6e-06) 27 8.2 SB_40116| Best HMM Match : EGF (HMM E-Value=0) 27 8.2 SB_13309| Best HMM Match : EGF (HMM E-Value=0) 27 8.2 SB_54457| Best HMM Match : EGF (HMM E-Value=4.6e-31) 27 8.2 SB_49700| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_46360| Best HMM Match : EGF (HMM E-Value=0) 27 8.2 SB_43621| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 >SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 2411 Score = 66.5 bits (155), Expect = 8e-12 Identities = 40/142 (28%), Positives = 68/142 (47%), Gaps = 4/142 (2%) Frame = +3 Query: 3 QFLLETGAGIVKVKGDRPLQLNEWHTIRISRTGSRLTMDVDNSGPFIAESPDQWTVLEL- 179 ++ TG G++KV D L LN+ I+I+R G R+ + V+ P WT L+L Sbjct: 2084 EYRYNTGQGVIKVASDTALPLNKPIAIQIARDGLRVVLTVNGKRFTTIREPGSWTGLDLL 2143 Query: 180 NQPLYIGGVPDFDQLPIDLAGASGFVGCISMLILGNEEKNIMALALEK---ENVQNCFTC 350 + PLY+G L + ++ FVGCI + + + + A + ++ V+ C C Sbjct: 2144 DSPLYLGVSQSEANLQTRVGVSTSFVGCIRDFRVEDPDLRLRAASFDQLTVNQVRRC-GC 2202 Query: 351 APNLCLNNGVCQEALTEHGYVC 416 C N GVC + + ++ C Sbjct: 2203 RDGGCANGGVCTKRIKDYRCEC 2224 Score = 35.9 bits (79), Expect = 0.013 Identities = 21/66 (31%), Positives = 35/66 (53%) Frame = +3 Query: 21 GAGIVKVKGDRPLQLNEWHTIRISRTGSRLTMDVDNSGPFIAESPDQWTVLELNQPLYIG 200 G G + ++ + L +W+T+R R+G R V N SP + L ++ P+++G Sbjct: 1955 GNGPLLLESLNSINLRQWNTLRAMRSG-RYGRLVLNGVEVSGSSPPSLSKLNVDLPMFLG 2013 Query: 201 GVPDFD 218 GVP FD Sbjct: 2014 GVP-FD 2018 >SB_46304| Best HMM Match : Laminin_G_2 (HMM E-Value=0) Length = 645 Score = 63.7 bits (148), Expect = 6e-11 Identities = 36/143 (25%), Positives = 70/143 (48%), Gaps = 5/143 (3%) Frame = +3 Query: 3 QFLLETGAGIVKVKGDRPLQLNEWHTIRISRTGSRLTMDVDNSGPFIAESPDQWTVLELN 182 +F + G G ++ + + + +WHT+ R ++ +D+ +++P L L Sbjct: 312 EFRYDLGYGRAVIRSKKNITVGQWHTVVAERYRRDGSLILDSEPAVKSQAPCCSVGLNLA 371 Query: 183 QPLYIGGVPDFDQLPIDLAGAS-GFVGCISMLILGNEEKNIMALALEKENVQNC----FT 347 PLY+GGV +F+ + D G + GF GCIS + + + +++ ++ ++ C Sbjct: 372 LPLYVGGVLNFETIDTDKVGVNRGFKGCISDVAVDDNPIDLINSYVKHRGIEQCTECLLP 431 Query: 348 CAPNLCLNNGVCQEALTEHGYVC 416 C C+NNG C + GY+C Sbjct: 432 CQIEPCVNNGTCIPR-GQTGYMC 453 Score = 56.4 bits (130), Expect = 9e-09 Identities = 37/128 (28%), Positives = 62/128 (48%), Gaps = 1/128 (0%) Frame = +3 Query: 3 QFLLETG-AGIVKVKGDRPLQLNEWHTIRISRTGSRLTMDVDNSGPFIAESPDQWTVLEL 179 +F + G AG ++ + L L +W+T+ ++R S T+ VD+ S + T L L Sbjct: 97 EFRFDLGSAGPAIIRSHQQLTLYQWYTVVLTRQESEGTLQVDSQPVRRGSSKGKSTGLNL 156 Query: 180 NQPLYIGGVPDFDQLPIDLAGASGFVGCISMLILGNEEKNIMALALEKENVQNCFTCAPN 359 NQ +++GGV ++ ++ GF+GCIS + + N E V C+P Sbjct: 157 NQNMFLGGVANYSKIDRFSGFNRGFIGCISYIKVDNNTIRPGYKGRTCEGVGE--RCSPG 214 Query: 360 LCLNNGVC 383 +C N G C Sbjct: 215 VC-NKGRC 221 Score = 49.2 bits (112), Expect = 1e-06 Identities = 29/109 (26%), Positives = 50/109 (45%) Frame = +3 Query: 15 ETGAGIVKVKGDRPLQLNEWHTIRISRTGSRLTMDVDNSGPFIAESPDQWTVLELNQPLY 194 E GAG ++ R + +WH +++ R + +D+ S + L P++ Sbjct: 532 ELGAGPAVLRSRRRVDDGQWHFVKVFRRSQDGALQIDDDEIVNGTSKNGARSLNTPGPIF 591 Query: 195 IGGVPDFDQLPIDLAGASGFVGCISMLILGNEEKNIMALALEKENVQNC 341 IGG D + L AS F GC+S + L N + ++ A++ NV C Sbjct: 592 IGGGDDVETLTYGKYAAS-FRGCVSGIYLQNRKLRVLEDAVQGYNVMQC 639 >SB_32282| Best HMM Match : Laminin_G_2 (HMM E-Value=0) Length = 897 Score = 54.0 bits (124), Expect = 5e-08 Identities = 35/137 (25%), Positives = 66/137 (48%), Gaps = 5/137 (3%) Frame = +3 Query: 3 QFLLETGAGIVKVKGDRPLQLNEWHTIRISRTGSRLTMDVDNSGPFIAES-PDQWTVLEL 179 +F GA I +V+ + + LN+WH + + R + VDN G + +S ++++L Sbjct: 375 EFRFSCGADIAQVRSRQNITLNQWHNVVVFRDKRDAHLMVDN-GDLVTQSLKGTQSMMDL 433 Query: 180 NQPLYIGGVPDFDQLPID-LAGASGFVGCISMLILGNEEKNI-MAL--ALEKENVQNCFT 347 L++GGVP ++ D + SGF GC+ ++ ++ AL ++ V+ C Sbjct: 434 KTRLFLGGVPRMRRVTSDAVPYHSGFTGCVKSFVVDGRMLDLSQALGDVVKSRQVEECGE 493 Query: 348 CAPNLCLNNGVCQEALT 398 C +N C A++ Sbjct: 494 SRDCECHHNAPCHYAVS 510 Score = 39.1 bits (87), Expect = 0.001 Identities = 25/90 (27%), Positives = 42/90 (46%) Frame = +3 Query: 72 WHTIRISRTGSRLTMDVDNSGPFIAESPDQWTVLELNQPLYIGGVPDFDQLPIDLAGASG 251 WH+++ R + VD+ S Q+ L + L+IGG P +D SG Sbjct: 811 WHSVKFVRKSLAAYLKVDDEIKAGIASDSQYRQLN-SDVLFIGGAPT-----VDRRFMSG 864 Query: 252 FVGCISMLILGNEEKNIMALALEKENVQNC 341 VGC+ LI+G+ ++ + +NV+ C Sbjct: 865 LVGCLKDLIVGDVPVDLASEVTSGQNVRPC 894 >SB_55345| Best HMM Match : Laminin_G_2 (HMM E-Value=2e-31) Length = 189 Score = 53.6 bits (123), Expect = 6e-08 Identities = 29/96 (30%), Positives = 52/96 (54%), Gaps = 1/96 (1%) Frame = +3 Query: 3 QFLLETG-AGIVKVKGDRPLQLNEWHTIRISRTGSRLTMDVDNSGPFIAESPDQWTVLEL 179 +F + G AG ++ + L L +W+T+ ++R S T+ VD+ S + T L L Sbjct: 88 EFRFDLGSAGPAIIRSHQQLTLYQWYTVVLTRQESEGTLQVDSQPVRRGSSKGKSTGLNL 147 Query: 180 NQPLYIGGVPDFDQLPIDLAGASGFVGCISMLILGN 287 NQ +++GGV ++ ++ GF+GCIS + + N Sbjct: 148 NQNMFLGGVANYSKIDRFSGFNRGFIGCISYIKVDN 183 >SB_7343| Best HMM Match : EGF (HMM E-Value=0) Length = 1233 Score = 49.6 bits (113), Expect = 1e-06 Identities = 47/158 (29%), Positives = 70/158 (44%), Gaps = 20/158 (12%) Frame = +3 Query: 3 QFLLE--TGAGIVKVKGDRPLQLNEWHTIRISRTGSRLTMDVDNSGPFIAESPDQWTVLE 176 Q LL+ G+G+ +++ + +WHT+ R+G + DN S L+ Sbjct: 837 QILLQYNLGSGLARIRSCSLNKTQDWHTVTAGRSGPEGYVYADNCEKVRGSSEGNLQGLD 896 Query: 177 LNQPLYIGGVPDFDQLPIDLAGASGFVGCI-SMLI-LGNEE--KNIMALALE-------- 320 L PL+IGGV D +LP + SGF G + M I N+E +N+ L + Sbjct: 897 LYAPLFIGGVHDLSELPTYVDFKSGFRGNLYGMAIRFSNQEYWRNLSLLQTQGVSERVEA 956 Query: 321 -----KENVQNCFTCAPNLCLNNGVC-QEALTEHGYVC 416 E+ C + P CLN G C + A T YVC Sbjct: 957 GSNIGNESYNECISQTPP-CLNGGNCTRHAAT---YVC 990 Score = 47.6 bits (108), Expect = 4e-06 Identities = 29/116 (25%), Positives = 55/116 (47%), Gaps = 5/116 (4%) Frame = +3 Query: 15 ETGAGIVKVKGDRPLQLNEWHTIRISRTGSRLTMDVDNSGPFIAESPDQWTVLELNQPLY 194 + G+GI + +P+ +N T+ ++RT + ++ ++N P SP L++ LY Sbjct: 1113 DLGSGIGFGQTTQPVTINTEVTVILNRTRNSGSLQLNNDPPVAFTSPGNAVALDVTSNLY 1172 Query: 195 IGGVPDFDQL----PIDLAGASGFVGCISMLILGNEEKNIMAL-ALEKENVQNCFT 347 +GG P + D+ + GCIS + N+ + + A+ N+ NC T Sbjct: 1173 LGGAPQLSSVNPRAVEDVISLRDYTGCISEAKVNNQALVLTEVGAVSGRNIDNCAT 1228 Score = 26.6 bits (56), Expect = 8.2 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +3 Query: 336 NCFTCAPNLCLNNGVCQEALTEHGYVC 416 N CA CLN G+C + + + +C Sbjct: 210 NIDDCASRPCLNGGLCVDGVNSYSCLC 236 >SB_25361| Best HMM Match : Cadherin (HMM E-Value=0) Length = 4833 Score = 45.2 bits (102), Expect = 2e-05 Identities = 23/61 (37%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Frame = +3 Query: 39 VKGDRPLQLNEWHTIRISRTGSRLTMDVDNSGPFIAESPDQWTVLELNQ-PLYIGGVPDF 215 +K DR + +WH + + R + + VD S E +T LELNQ PL +GG+ DF Sbjct: 3890 IKSDRAVTDGKWHHVTVIRDKKKGELLVDGSNKKTGEVDGGFTQLELNQSPLLVGGIKDF 3949 Query: 216 D 218 D Sbjct: 3950 D 3950 >SB_42841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1651 Score = 41.5 bits (93), Expect = 3e-04 Identities = 32/113 (28%), Positives = 54/113 (47%), Gaps = 6/113 (5%) Frame = +3 Query: 6 FLLETGAGIVKVKGDRPLQL--NEW---HTIRISRTGSRLTMDVDNSGPFIAESPDQWTV 170 F +TGAG+V+V+ + W H +RI++ G L D + A D + Sbjct: 1336 FKYDTGAGLVRVESNFNYYSAGGVWYKVHLLRINQFGVILVPDTKDYKN--ARQGDSREL 1393 Query: 171 LELNQPLYIGGVPDFDQLPIDLAGASGFVGCI-SMLILGNEEKNIMALALEKE 326 L +N P+Y+GGVP + +G F+GC+ +M I + E + E++ Sbjct: 1394 LTINTPIYMGGVPPGVNTSMLESGGVSFIGCMKTMSIQSSNETETLNPRTERD 1446 Score = 38.3 bits (85), Expect = 0.003 Identities = 19/49 (38%), Positives = 25/49 (51%) Frame = +3 Query: 66 NEWHTIRISRTGSRLTMDVDNSGPFIAESPDQWTVLELNQPLYIGGVPD 212 N++H IR+ R +T+ VD P PD + L YIGGVPD Sbjct: 1556 NQFHEIRLQRAERNITLSVDKHSPLTYALPDLFL---LTGKFYIGGVPD 1601 Score = 30.3 bits (65), Expect = 0.67 Identities = 24/67 (35%), Positives = 34/67 (50%), Gaps = 4/67 (5%) Frame = +3 Query: 72 WHTIRISRTGSRLTMDVDNSGPFIAESPDQWTVL----ELNQPLYIGGVPDFDQLPIDLA 239 +HT+ I+ T + L +D+D G + S D TV LN LY+GGV LP+ + Sbjct: 1184 YHTVVITFTAAGLRLDLDE-GRW-TRSVDLSTVAAGPARLNGTLYVGGVRPGAVLPLQVP 1241 Query: 240 GASGFVG 260 FVG Sbjct: 1242 VVLPFVG 1248 >SB_35857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2680 Score = 41.1 bits (92), Expect = 4e-04 Identities = 32/122 (26%), Positives = 46/122 (37%), Gaps = 5/122 (4%) Frame = +3 Query: 6 FLLETGAGIVKVKGDRPLQLNEWHTIRISRTGSRLTMDVDNSGPFIAESPDQWTVLELNQ 185 F +TG V N+WH ++++R S T+ VD S T + + Sbjct: 1398 FDCQTGPAAFTVSAAVTFDDNQWHRLQLTRKDSVGTLTVDGIYTASGSSSGASTFISMGT 1457 Query: 186 PLYIGGVP-DF----DQLPIDLAGASGFVGCISMLILGNEEKNIMALALEKENVQNCFTC 350 +YIGG+P DF P G F+GCI + A+ KE V Sbjct: 1458 GVYIGGLPTDFIITRSDPPAARVGRYPFIGCIKSVTSQGSGPWQWEQAVAKEGVDPVMNA 1517 Query: 351 AP 356 P Sbjct: 1518 CP 1519 >SB_9507| Best HMM Match : Cadherin (HMM E-Value=0) Length = 2735 Score = 41.1 bits (92), Expect = 4e-04 Identities = 44/150 (29%), Positives = 60/150 (40%), Gaps = 22/150 (14%) Frame = +3 Query: 33 VKVKGDRPLQLNEWHTIRISR--TGSRLTMD---VDNSGPFIAESPDQ------------ 161 + V G L EWH I I R T R+T+D N + S D+ Sbjct: 1777 IGVTGGAMLNDGEWHMIEIHRDETTVRVTVDRCRASNISEGVTRSEDRSMCEVVGHMKKK 1836 Query: 162 -WTVLELNQPLYIGGVPDFDQLPIDLAGASGFVGCISMLILGNEEKNIMALALEKENVQN 338 L LN PL +GG+ D L DL F GCI LI ++ + + + + Sbjct: 1837 KLKFLNLNDPLQLGGIASRDLLFPDLR-FHDFNGCIRNLINEGRLYDLKSPSRQNNTREG 1895 Query: 339 CFT----CAPNLCLNNGVCQEALTEHGYVC 416 C T C PN C C +L +G+VC Sbjct: 1896 CATMDQHCNPNSCHEQATCIGSL--NGHVC 1923 >SB_7492| Best HMM Match : Laminin_G_2 (HMM E-Value=0.0025) Length = 87 Score = 39.5 bits (88), Expect = 0.001 Identities = 20/72 (27%), Positives = 37/72 (51%), Gaps = 4/72 (5%) Frame = +3 Query: 6 FLLETGAGIVKVK--GDRPLQL--NEWHTIRISRTGSRLTMDVDNSGPFIAESPDQWTVL 173 F +E G G +V+ ++L +WH + +++ + ++ VD + P +SP Sbjct: 3 FRVENGNGPFEVRYTPSNSMELCDGKWHRVNLNKIRNTASIQVDGNDPVEVKSPGSLGNT 62 Query: 174 ELNQPLYIGGVP 209 L PLY+GG+P Sbjct: 63 NLYDPLYVGGIP 74 >SB_13148| Best HMM Match : Laminin_G_2 (HMM E-Value=6.4e-27) Length = 262 Score = 38.7 bits (86), Expect = 0.002 Identities = 33/102 (32%), Positives = 47/102 (46%), Gaps = 1/102 (0%) Frame = +3 Query: 12 LETGAGIVKVKGDRPLQLNEWHTIRISRTGSRLTMDVDNSGPFIAESPDQWTVLELNQPL 191 L TG G++ +G R L N+WH + ISRT + + VD G S + + L+ P Sbjct: 149 LGTGRGLIISRGPR-LHDNKWHNVLISRTDRTIALSVD--GRLEGSSSTRGSFTRLDIPD 205 Query: 192 YIGGVPDFDQLPIDLAGASG-FVGCISMLILGNEEKNIMALA 314 +G F P ++G G F GCI L + E A A Sbjct: 206 AVG---LFLGAPSTISGIVGNFRGCIRDLRIDGREPITNAFA 244 >SB_47423| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 855 Score = 37.1 bits (82), Expect = 0.006 Identities = 22/71 (30%), Positives = 32/71 (45%), Gaps = 3/71 (4%) Frame = +3 Query: 72 WHTIRISRTGSRLTMDVDNSGPFIAESPDQWTVLEL---NQPLYIGGVPDFDQLPIDLAG 242 WH++ I R R+T+D+D P Q++ L+ + LY G PD D L + Sbjct: 356 WHSVTIHRKRRRVTLDLDKQKRVTVVIPGQFSFLDFKGGQEKLYFCGGPDSDTLAYSYS- 414 Query: 243 ASGFVGCISML 275 F G I L Sbjct: 415 RKNFTGIIQQL 425 >SB_11569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 488 Score = 36.3 bits (80), Expect = 0.010 Identities = 21/70 (30%), Positives = 37/70 (52%), Gaps = 3/70 (4%) Frame = +3 Query: 66 NEWHTIRISRTGSRLTMDVDNSGPFIAESPDQWTVLELNQPLYIGGVPDFDQLPIDLAG- 242 N+WHT++++R L + +DN + + L+L++ +++GGV LP D G Sbjct: 16 NKWHTVKVARNQRSLLLTLDNK-ETRTNTAGSFVRLDLDKFIFVGGVD--RSLPDDYHGA 72 Query: 243 --ASGFVGCI 266 A F GC+ Sbjct: 73 RDAPNFKGCL 82 Score = 28.7 bits (61), Expect = 2.0 Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 5/62 (8%) Frame = +3 Query: 246 SGFVGCISMLILGNEEKNIMALALEKEN--VQNCFT---CAPNLCLNNGVCQEALTEHGY 410 +GFVGC++ + L L+ E + C C PN C N G C+E+ + Sbjct: 247 TGFVGCMNNIKLNGALVRPRKLSKEVAGAVIGRCSITSKCFPNPCQNGGACKESWDSYTC 306 Query: 411 VC 416 C Sbjct: 307 DC 308 >SB_39328| Best HMM Match : Laminin_G_2 (HMM E-Value=0) Length = 1049 Score = 35.1 bits (77), Expect = 0.023 Identities = 26/97 (26%), Positives = 43/97 (44%), Gaps = 2/97 (2%) Frame = +3 Query: 3 QFLLETGAGIVKVKGDRPLQ--LNEWHTIRISRTGSRLTMDVDNSGPFIAESPDQWTVLE 176 +F + G G+VK+ + L E +RI G+ L + + T L+ Sbjct: 746 KFQFDLGPGLVKMSTELSYTGALTEMKLLRIGSFGALLVPAWKEYQNYKNYEATR-TTLD 804 Query: 177 LNQPLYIGGVPDFDQLPIDLAGASGFVGCISMLILGN 287 L P+YIGGVP+ ++ + GF G + LG+ Sbjct: 805 LTSPIYIGGVPEHVKVHPQVTRRFGFSGYFQKVALGS 841 >SB_17959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 843 Score = 35.1 bits (77), Expect = 0.023 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = +3 Query: 66 NEWHTIRISRTGSRLTMDVDNSGPFIAESPDQWTVLELNQPLYIGGV 206 NEWH + + RTG + + +D + +P + LEL+ +YI GV Sbjct: 120 NEWHQVELRRTGLNILLILDVTRK-SKVAPGSYNTLELDNRIYIAGV 165 >SB_25851| Best HMM Match : Laminin_G_2 (HMM E-Value=0) Length = 683 Score = 34.3 bits (75), Expect = 0.041 Identities = 25/97 (25%), Positives = 37/97 (38%), Gaps = 3/97 (3%) Frame = +3 Query: 12 LETGAGIVKVKGDRPLQLNEWHTIRISRTGSRLTMDVDNSGPFIAESPDQWTVLEL---N 182 L+ GAG++K+ L WH I R + + +D P T + Sbjct: 309 LDIGAGMLKLSIGEKLSDARWHRAEIKRARRNVKLTLDERLKVDGTCPPSLTAFNMQGGE 368 Query: 183 QPLYIGGVPDFDQLPIDLAGASGFVGCISMLILGNEE 293 +YIGGV D + + F GCI L+ E Sbjct: 369 GRVYIGGVSDPTRSK-NSVSRKNFEGCIRKLVFNFNE 404 >SB_32719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 604 Score = 33.5 bits (73), Expect = 0.072 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +3 Query: 348 CAPNLCLNNGVCQEALTEHGYVC 416 C PN C N+G C++ T G+VC Sbjct: 233 CTPNPCKNDGTCRDISTGRGFVC 255 >SB_30923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 642 Score = 33.1 bits (72), Expect = 0.095 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 348 CAPNLCLNNGVCQEALTEHGYVC 416 C PN C N G C + TE G+VC Sbjct: 75 CHPNPCKNGGTCTRSDTESGFVC 97 >SB_22957| Best HMM Match : EGF (HMM E-Value=7e-39) Length = 201 Score = 32.7 bits (71), Expect = 0.12 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 348 CAPNLCLNNGVCQEALTEHGYVC 416 C PN C N GVC+E + Y C Sbjct: 33 CDPNPCQNGGVCKETFDRNNYTC 55 >SB_2152| Best HMM Match : EGF (HMM E-Value=0) Length = 1603 Score = 32.7 bits (71), Expect = 0.12 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 348 CAPNLCLNNGVCQEALTEHGYVC 416 C PN C N GVC+E + Y C Sbjct: 57 CDPNPCQNGGVCKETFDRNNYTC 79 Score = 27.9 bits (59), Expect = 3.6 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 333 QNCFTCAPNLCLNNGVCQEALTEHGYVC 416 +N C PN CLN G C + + +G+ C Sbjct: 211 ENIDECDPNPCLNGGTCVDGI--NGFNC 236 >SB_35194| Best HMM Match : EGF_2 (HMM E-Value=0) Length = 960 Score = 32.3 bits (70), Expect = 0.17 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +3 Query: 282 GNEEKNIMALALEKENVQNC--FTCAPNLCLNNGVCQEALTEHGYVC 416 G EK L + C + C PN C N G C+++L +VC Sbjct: 109 GRIEKKESCYCLPGYHGDGCQHYGCTPNPCQNGGTCKQSLQNGSFVC 155 >SB_41795| Best HMM Match : EGF (HMM E-Value=8.7e-11) Length = 83 Score = 31.9 bits (69), Expect = 0.22 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +3 Query: 348 CAPNLCLNNGVCQEALTEHGYVC 416 C+PN C N GVC E T GY C Sbjct: 47 CSPNPCQNGGVCTETAT--GYTC 67 >SB_38062| Best HMM Match : EGF (HMM E-Value=1.8e-07) Length = 44 Score = 31.9 bits (69), Expect = 0.22 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = +3 Query: 348 CAPNLCLNNGVCQEALTEHGYVC 416 C PN CLNNGVC+E GY C Sbjct: 11 CHPNPCLNNGVCRE--NGGGYDC 31 >SB_786| Best HMM Match : EGF (HMM E-Value=0) Length = 1427 Score = 31.9 bits (69), Expect = 0.22 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 348 CAPNLCLNNGVCQEALTEHGYVC 416 C PN CLN G+C +++ + GY C Sbjct: 274 CVPNPCLNGGIC-KSVADKGYQC 295 Score = 29.1 bits (62), Expect = 1.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 348 CAPNLCLNNGVCQEALTEHGYVC 416 CAPN CLN G C T H C Sbjct: 311 CAPNPCLNGGTCVVFYTVHLCKC 333 Score = 28.3 bits (60), Expect = 2.7 Identities = 11/18 (61%), Positives = 13/18 (72%), Gaps = 1/18 (5%) Frame = +3 Query: 333 QNCFT-CAPNLCLNNGVC 383 +NC C+PN C NNGVC Sbjct: 195 KNCENFCSPNPCKNNGVC 212 Score = 27.5 bits (58), Expect = 4.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 348 CAPNLCLNNGVCQEALTEHGYVC 416 C PN C N+G+C ++ G+VC Sbjct: 102 CKPNPCANSGLCIHT-SDGGFVC 123 >SB_3456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 462 Score = 31.9 bits (69), Expect = 0.22 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +3 Query: 312 ALEKENVQNCFTCAPNLCLNNGVCQEALTEHGYVC 416 +L V C PN CLN G+C T+H C Sbjct: 236 SLSATYVSTVTACQPNPCLNGGLCSRFGTQHSCQC 270 Score = 31.5 bits (68), Expect = 0.29 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +3 Query: 306 ALALEKENVQNCFTCAPNLCLNNGVCQEALTEHGYVC 416 A+ +N + C P+ C N G C E TE GY C Sbjct: 105 AVGFRGDNCEEPSKCHPSPCRNGGECSE--TEEGYTC 139 >SB_50262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 830 Score = 31.5 bits (68), Expect = 0.29 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = -1 Query: 413 HITMLSKCFLTDTIVETEIRGTSETILDIFFL 318 HI M KC LT+TIVE G T D+F + Sbjct: 660 HIDMKCKCDLTETIVELYENGKETTHFDLFHM 691 >SB_33543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 838 Score = 31.5 bits (68), Expect = 0.29 Identities = 22/54 (40%), Positives = 25/54 (46%), Gaps = 9/54 (16%) Frame = +3 Query: 249 GFVGCISMLILGNEEKNIMALALEKENVQN------CFT---CAPNLCLNNGVC 383 GFVGC ML L + I A L K+ N C T C PN C+N G C Sbjct: 343 GFVGC--MLNLRIDSHKITARHLSKQKYSNGIDATKCATSNRCFPNPCINRGTC 394 Score = 31.1 bits (67), Expect = 0.38 Identities = 19/86 (22%), Positives = 42/86 (48%) Frame = +3 Query: 21 GAGIVKVKGDRPLQLNEWHTIRISRTGSRLTMDVDNSGPFIAESPDQWTVLELNQPLYIG 200 G +++ + L +WHT+ ++R G + VD+ +P + L L+ ++IG Sbjct: 82 GVDKTEIQLGKDLFNGKWHTVSVNRNGRLTMLSVDDLST-TKITPGPYDHLNLDGLIFIG 140 Query: 201 GVPDFDQLPIDLAGASGFVGCISMLI 278 G+ + + + A + GC+S ++ Sbjct: 141 GLSVNTKNKVRIK-ALNYRGCLSDIV 165 >SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3287 Score = 31.1 bits (67), Expect = 0.38 Identities = 24/91 (26%), Positives = 41/91 (45%), Gaps = 4/91 (4%) Frame = +3 Query: 15 ETGAGIVKVKGDRPLQLNEWHTIRISRTGSRLTMDVDNSGPFIAESPDQWTVLELNQP-- 188 + G+G V + +WH I SR RL + VD+ ++ +Q +VL++ Sbjct: 1569 DLGSGPGSVINPMTVNDGDWHHITWSRQYKRLILSVDDVTMEMSTQGEQ-SVLDVADSEI 1627 Query: 189 --LYIGGVPDFDQLPIDLAGASGFVGCISML 275 ++IGG P L+ + F GC+ L Sbjct: 1628 IYVHIGGFPYLKSSATGLSTITSFQGCLKDL 1658 Score = 30.3 bits (65), Expect = 0.67 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +3 Query: 336 NCFTCAPNLCLNNGVCQEALTEHGYVC 416 N C + CLNNG C E + GY C Sbjct: 855 NVVECLSDPCLNNGTCVEKIGVVGYQC 881 Score = 29.9 bits (64), Expect = 0.88 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +3 Query: 333 QNCFTCAPNLCLNNGVCQEALTEHGYVC 416 +N C PN CLN C + + ++ VC Sbjct: 2241 ENINECDPNPCLNGATCLDKIADYACVC 2268 Score = 29.5 bits (63), Expect = 1.2 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 336 NCFTCAPNLCLNNGVCQEALTEHGYVC 416 N CA CLNNG CQ+ VC Sbjct: 779 NIDECASQPCLNNGTCQDGRGNFSCVC 805 >SB_52794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1408 Score = 31.1 bits (67), Expect = 0.38 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 348 CAPNLCLNNGVCQEALTEHGYVC 416 C PN C N GVC+E + Y C Sbjct: 480 CDPNPCQNGGVCKETFDRNIYTC 502 >SB_40275| Best HMM Match : Cadherin (HMM E-Value=0) Length = 1747 Score = 30.7 bits (66), Expect = 0.50 Identities = 17/69 (24%), Positives = 33/69 (47%), Gaps = 2/69 (2%) Frame = +3 Query: 3 QFLLETGAGIVKVKGDRPLQLN--EWHTIRISRTGSRLTMDVDNSGPFIAESPDQWTVLE 176 + + G V VK D+ +L+ EWHT+++ R + + +D + E TV+E Sbjct: 1101 ELFVSLGLDPVTVKMDKGPRLDDGEWHTVQVLRNMKDIEIIIDRCSTALLEHKPDGTVVE 1160 Query: 177 LNQPLYIGG 203 + ++ G Sbjct: 1161 NRKSCHVYG 1169 Score = 30.7 bits (66), Expect = 0.50 Identities = 14/49 (28%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +3 Query: 252 FVGCIS-MLILGNEEKNIMALALEKENVQNCFTCAPNLCLNNGVCQEAL 395 F GCI+ + G ++ ++ + ++NV + C N C N G C +A+ Sbjct: 1487 FGGCIAGTSVNGANMESDPSIKVHRQNVLDGCPCLSNFCANGGTCVDAM 1535 >SB_8425| Best HMM Match : EGF (HMM E-Value=0) Length = 1955 Score = 30.3 bits (65), Expect = 0.67 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +3 Query: 348 CAPNLCLNNGVCQEALTEHGYVC 416 CA N CLNNG C + + +GY C Sbjct: 588 CAKNPCLNNGACVDQV--NGYTC 608 >SB_3457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 848 Score = 30.3 bits (65), Expect = 0.67 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +3 Query: 348 CAPNLCLNNGVCQEALTEHGYVC 416 C PN CLN+GVC L H Y C Sbjct: 297 CEPNPCLNDGVCTAFL--HDYEC 317 Score = 29.5 bits (63), Expect = 1.2 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 348 CAPNLCLNNGVCQEALTEHGYVC 416 C PN CL+ G C E E GY C Sbjct: 695 CHPNPCLHGGTCDE--KEDGYTC 715 >SB_4760| Best HMM Match : EGF (HMM E-Value=8.29989e-42) Length = 240 Score = 29.9 bits (64), Expect = 0.88 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 348 CAPNLCLNNGVCQEALTEHGYVC 416 C N C+N G C E L+ GY C Sbjct: 79 CQKNPCMNGGKCVETLSGTGYEC 101 >SB_20112| Best HMM Match : EGF (HMM E-Value=0) Length = 2112 Score = 29.5 bits (63), Expect = 1.2 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +3 Query: 348 CAPNLCLNNGVCQEALTEHGYVC 416 CA N C N+G CQ+ + ++ +C Sbjct: 379 CASNPCQNDGTCQDGIAQYTCLC 401 >SB_7108| Best HMM Match : Pili_assembly_C (HMM E-Value=0.83) Length = 401 Score = 29.5 bits (63), Expect = 1.2 Identities = 22/86 (25%), Positives = 39/86 (45%), Gaps = 1/86 (1%) Frame = +3 Query: 9 LLETGAGIVKVKGDRPL-QLNEWHTIRISRTGSRLTMDVDNSGPFIAESPDQWTVLELNQ 185 +L+TGA ++ KG+R + +N + + +T + N+ FIA +N Sbjct: 282 ILQTGANVMSAKGNRNIAAVNASESYTTLKEAFSVTFEEINN--FIASGKLTVNDKTINL 339 Query: 186 PLYIGGVPDFDQLPIDLAGASGFVGC 263 ++GG F L + L GA+ C Sbjct: 340 EFFLGGDYKFVLLMLGLKGATANYAC 365 >SB_47131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 726 Score = 29.1 bits (62), Expect = 1.5 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = +3 Query: 348 CAPNLCLNNGVCQE--ALTEHGYVC 416 C PN C NN CQE + +GY C Sbjct: 64 CQPNPCRNNATCQEHTGIGCYGYYC 88 >SB_31961| Best HMM Match : EGF (HMM E-Value=0) Length = 2813 Score = 29.1 bits (62), Expect = 1.5 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +3 Query: 348 CAPNLCLNNGVCQEALTEHGYVC 416 CA N C NNG C++ + +GY C Sbjct: 1596 CASNPCQNNGYCEDLI--NGYYC 1616 >SB_16935| Best HMM Match : Cadherin (HMM E-Value=0) Length = 2204 Score = 29.1 bits (62), Expect = 1.5 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +3 Query: 330 VQNCFTCAPNLCLNNGVCQEALTEHGYVC 416 +Q+ C PN CL+ G C E+ VC Sbjct: 1981 LQDWRNCEPNPCLHGGTCYPLSNEYACVC 2009 >SB_58558| Best HMM Match : EGF (HMM E-Value=0) Length = 1101 Score = 28.7 bits (61), Expect = 2.0 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +3 Query: 348 CAPNLCLNNGVCQEALTEHGYVC 416 C PN CLN G C + + +GY C Sbjct: 545 CQPNPCLNGGSCTDRV--NGYTC 565 Score = 27.1 bits (57), Expect = 6.2 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +3 Query: 321 KENVQNCFTCAPNLCLNNGVCQEALTEHGYVC 416 K +N C PN C N G C + L + Y+C Sbjct: 422 KNCTENINDCDPNPCGNGGTCTDQL--NAYLC 451 >SB_19005| Best HMM Match : EGF (HMM E-Value=1.4e-20) Length = 99 Score = 28.7 bits (61), Expect = 2.0 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +3 Query: 318 EKENVQNCFTCAPNLCLNNGVCQEALTEHGYVC 416 E E+ C PN CL+ G+C+E ++ + Y C Sbjct: 54 EHEDSYRHHLCHPNPCLHGGICKE-ISGNDYEC 85 >SB_13146| Best HMM Match : Laminin_G_2 (HMM E-Value=1.5e-25) Length = 614 Score = 28.7 bits (61), Expect = 2.0 Identities = 24/86 (27%), Positives = 41/86 (47%), Gaps = 1/86 (1%) Frame = +3 Query: 12 LETGAGIVKVKGDRPLQLNEWHTIRISRTGSRLTMDVDNSGPFIAESPDQWTVLELNQPL 191 L TG V +G R + EWH++ I+R L + VDN G ++ + +++ P Sbjct: 501 LGTGRSKVYAEGIR-VDDGEWHSVVITREKKTLAISVDN-GRAKGQTDTRGDFNKIDLPN 558 Query: 192 YIGGVPDFDQLPIDLAG-ASGFVGCI 266 +G + +P + G F+GCI Sbjct: 559 SVGLILG---VPSTVKGLVPNFIGCI 581 >SB_6077| Best HMM Match : EGF (HMM E-Value=0) Length = 1165 Score = 28.3 bits (60), Expect = 2.7 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +3 Query: 348 CAPNLCLNNGVCQEALTEHGYVC 416 C+ + C+N GVC + L E+ +C Sbjct: 219 CSSSPCVNGGVCADGLGEYKCIC 241 Score = 27.9 bits (59), Expect = 3.6 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 336 NCFTCAPNLCLNNGVCQEALTEHGYVC 416 N C+P+ C + G CQ+ +T GY+C Sbjct: 747 NIDDCSPSPCRHGGSCQDLVT--GYLC 771 Score = 27.9 bits (59), Expect = 3.6 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 348 CAPNLCLNNGVCQEALTEHGYVC 416 CA N C NNG C + + + VC Sbjct: 789 CATNPCDNNGTCVDRVASYDCVC 811 Score = 26.6 bits (56), Expect = 8.2 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +3 Query: 336 NCFTCAPNLCLNNGVCQEALTEHGYVC 416 N CA + CLNN +C + + + C Sbjct: 823 NIDDCATSPCLNNAICTDLINDFHCAC 849 >SB_32721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 637 Score = 27.9 bits (59), Expect = 3.6 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +3 Query: 348 CAPNLCLNNGVCQEALTEHGYVC 416 CA + CLN+G C+E T GY C Sbjct: 525 CASDPCLNDGTCKE--TPAGYRC 545 >SB_32588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1135 Score = 27.9 bits (59), Expect = 3.6 Identities = 25/106 (23%), Positives = 44/106 (41%), Gaps = 2/106 (1%) Frame = +3 Query: 48 DRPLQLNE-WHTIRISRTGSRLTMDVDNSGPFIAESPDQWTVLELNQPLYIGGVPDFDQL 224 + PL N WH + + ++VD Q L++ L+IGG ++ Sbjct: 717 ENPLNTNRLWHKVVVWFNIKEFGLEVDGIRKIRLNPLQQSKQLDVVGNLFIGGY--MREM 774 Query: 225 PIDLAGASGFVGCISMLILGNEEKNIMALALEKENV-QNCFTCAPN 359 +GFVGCI + E N+ L+ + + V + C++ N Sbjct: 775 ------MNGFVGCIRGFTINGEVLNLARLSKDFDYVNEGCYSACNN 814 >SB_25220| Best HMM Match : Ank (HMM E-Value=6.2e-11) Length = 744 Score = 27.9 bits (59), Expect = 3.6 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 195 IGGVPDFDQLPIDLAGASGFVGCISMLI 278 I G F + + +A GFVGC+S+L+ Sbjct: 152 INGKTRFGRTSLHVAAYQGFVGCVSLLL 179 >SB_54456| Best HMM Match : EGF (HMM E-Value=2.3e-31) Length = 491 Score = 27.9 bits (59), Expect = 3.6 Identities = 13/46 (28%), Positives = 20/46 (43%) Frame = +3 Query: 279 LGNEEKNIMALALEKENVQNCFTCAPNLCLNNGVCQEALTEHGYVC 416 +GNE + + AL + + C PN C N C E ++ C Sbjct: 367 VGNEYRCVCALGYKGDRCDIQSKCFPNPCKNFATCTEHPNDYECTC 412 Score = 27.1 bits (57), Expect = 6.2 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 348 CAPNLCLNNGVCQEALTEHGYVC 416 C PN C N VC E T Y+C Sbjct: 427 CEPNPCRNGAVCTE--TREKYIC 447 >SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 27.9 bits (59), Expect = 3.6 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 348 CAPNLCLNNGVCQEALTEHGYVC 416 C PN C N G+C + GY C Sbjct: 99 CHPNPCRNGGMCTGTTSVTGYQC 121 >SB_29786| Best HMM Match : I-set (HMM E-Value=0) Length = 6300 Score = 27.5 bits (58), Expect = 4.7 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = +2 Query: 242 SIWFCRMYKHADTWQRREEHHGSSSRE--RKC 331 SI F ++Y+ A TW EH +S++E +KC Sbjct: 891 SIEFYQLYEQAATWMSDSEHFLNSTKEEAQKC 922 >SB_27922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1704 Score = 27.5 bits (58), Expect = 4.7 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 348 CAPNLCLNNGVCQEALTEHGYVC 416 C + CLNNG CQ + Y C Sbjct: 1584 CRISPCLNNGTCQAGFGDRKYRC 1606 >SB_5870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 27.5 bits (58), Expect = 4.7 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 363 CLNNGVCQEALTEHGYVC 416 C+N G+C+ T GY+C Sbjct: 108 CMNGGICEAIATCPGYIC 125 >SB_57231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 288 Score = 27.5 bits (58), Expect = 4.7 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +3 Query: 264 ISMLILGNEEKNIMALALEKENVQNCFTCAPNLCLNNG 377 ISM +L N K + L+K CFT C N+G Sbjct: 8 ISMSLLPNAAKKPKRMHLKKMKTTGCFTALCAACHNDG 45 >SB_45116| Best HMM Match : EGF (HMM E-Value=0) Length = 2023 Score = 27.5 bits (58), Expect = 4.7 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +3 Query: 348 CAPNLCLNNGVCQEALTEHGYVC 416 CA N CLN G C + + +GY C Sbjct: 280 CASNPCLNGGTCNDLV--NGYNC 300 Score = 27.5 bits (58), Expect = 4.7 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +3 Query: 348 CAPNLCLNNGVCQEALTEHGYVC 416 CA N CLN G C + + +GY C Sbjct: 1074 CASNPCLNGGTCNDLV--NGYNC 1094 >SB_33848| Best HMM Match : RasGEF_N (HMM E-Value=2.3e-13) Length = 899 Score = 27.5 bits (58), Expect = 4.7 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = -2 Query: 154 GDSAINGPLLSTSIVNLEPVLLMRIVCHSLSCKGRSPLTLTIPAP 20 GD + + STS N L R++ KG SPLT+T+ AP Sbjct: 142 GDGELLCGVRSTSECNDSEELSFRLIVRPKD-KGESPLTITLMAP 185 >SB_33579| Best HMM Match : Laminin_G_2 (HMM E-Value=3.2e-34) Length = 1071 Score = 27.5 bits (58), Expect = 4.7 Identities = 31/110 (28%), Positives = 42/110 (38%), Gaps = 6/110 (5%) Frame = +3 Query: 72 WH--TIRISRTGSRLTMDVDNSGPFIAESPDQWTVLELNQPLYIGGVPDFDQLPIDLAGA 245 WH T+++SR G L VD P Q +Y+G D Sbjct: 293 WHNVTVQVSRRGFSLA--VDRIEPVQVSFWVQIAEFRWFTAIYLGVAWDLQP-------- 342 Query: 246 SGFVGCIS-MLILGNEEKNIMALALEKENVQNCFT---CAPNLCLNNGVC 383 GFVGC+ + I G + ++ + C C PN CLN GVC Sbjct: 343 -GFVGCMKDVKIRGVKIRDQSVIRYRGPKFGVCPLENYCFPNPCLNGGVC 391 >SB_28495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6753 Score = 27.1 bits (57), Expect = 6.2 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 5/41 (12%) Frame = +3 Query: 309 LALEKENVQN--CFT---CAPNLCLNNGVCQEALTEHGYVC 416 LAL +EN++ C CA N C N+G C ++ C Sbjct: 4714 LALIEENIREKICLVVDKCATNPCKNSGTCTSVYSDFNCTC 4754 >SB_59261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5445 Score = 27.1 bits (57), Expect = 6.2 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +3 Query: 321 KENVQNCFT-CAPNLCLNNGVCQEALTEHGYVC 416 KE++ T C PN C N G C ++ + GY C Sbjct: 4132 KESLLTTVTLCNPNPCQNGGSC--SIADGGYTC 4162 >SB_40186| Best HMM Match : Extensin_2 (HMM E-Value=0.0036) Length = 362 Score = 27.1 bits (57), Expect = 6.2 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +3 Query: 135 PFIAESPDQWTVLELNQPLYIGGVPDFDQLPI 230 PF+A +P V+ L P Y +P F+ L + Sbjct: 284 PFLATTPSLLMVVTLTPPSYSHSIPSFNPLTL 315 >SB_1891| Best HMM Match : EGF (HMM E-Value=6.5e-15) Length = 106 Score = 27.1 bits (57), Expect = 6.2 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 5/41 (12%) Frame = +3 Query: 309 LALEKENVQN--CFT---CAPNLCLNNGVCQEALTEHGYVC 416 LAL +EN++ C CA N C N+G C ++ C Sbjct: 16 LALIEENIREKICLVVDKCATNPCKNSGTCTSVYSDFNCTC 56 >SB_47369| Best HMM Match : EGF (HMM E-Value=0.49) Length = 61 Score = 26.6 bits (56), Expect = 8.2 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 5/29 (17%) Frame = +3 Query: 345 TCAPNLCLNNGVCQ-----EALTEHGYVC 416 +C PN C N+GVC+ ++ E GY C Sbjct: 2 SCDPNPCQNSGVCKLGETSGSIGEFGYKC 30 >SB_44902| Best HMM Match : EGF (HMM E-Value=9.6e-06) Length = 335 Score = 26.6 bits (56), Expect = 8.2 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 309 LALEKENVQNCFTCAPNLCLNNGVCQEALTEHGYVC 416 L L ++ V+ C N C NNG C T++G +C Sbjct: 20 LDLREDTVRKTL-CEENGCQNNGTCFWNDTDYGCMC 54 >SB_40116| Best HMM Match : EGF (HMM E-Value=0) Length = 340 Score = 26.6 bits (56), Expect = 8.2 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +3 Query: 336 NCFTCAPNLCLNNGVCQEALTEHGYVC 416 N CA N CLN C + + ++ VC Sbjct: 153 NVDDCADNPCLNGATCIDGVNDYYCVC 179 >SB_13309| Best HMM Match : EGF (HMM E-Value=0) Length = 718 Score = 26.6 bits (56), Expect = 8.2 Identities = 11/24 (45%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = +3 Query: 348 CAPNLCLNNGVCQEAL-TEHGYVC 416 C+PN C N G C + L + GY C Sbjct: 345 CSPNPCENGGKCADDLGQDSGYRC 368 >SB_54457| Best HMM Match : EGF (HMM E-Value=4.6e-31) Length = 200 Score = 26.6 bits (56), Expect = 8.2 Identities = 12/24 (50%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = +3 Query: 348 CAP-NLCLNNGVCQEALTEHGYVC 416 C P N C NNGVC+E L + C Sbjct: 35 CHPVNPCQNNGVCKEDLDSYRCEC 58 >SB_49700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 7645 Score = 26.6 bits (56), Expect = 8.2 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +3 Query: 336 NCFTCAPNLCLNNGVCQEALTEHGYVC 416 N CA N CLN C + + ++ VC Sbjct: 7199 NVDDCADNPCLNGATCIDGVNDYYCVC 7225 >SB_46360| Best HMM Match : EGF (HMM E-Value=0) Length = 352 Score = 26.6 bits (56), Expect = 8.2 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +3 Query: 336 NCFTCAPNLCLNNGVCQEALTEHGYVC 416 N CA + CLNN +C + + + C Sbjct: 10 NIDDCATSPCLNNAICTDLINDFHCAC 36 >SB_43621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1122 Score = 26.6 bits (56), Expect = 8.2 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -2 Query: 340 QFW-TFSFSRARAMMFFSSLPSISMLIHPT 254 ++W T + A AM+F S+ I +L+HPT Sbjct: 104 RYWKTHEYYHACAMVFLFSVCHIMVLVHPT 133 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,809,719 Number of Sequences: 59808 Number of extensions: 246128 Number of successful extensions: 1185 Number of sequences better than 10.0: 66 Number of HSP's better than 10.0 without gapping: 892 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1178 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 777158991 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -