BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_A22 (416 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domai... 22 7.8 DQ370039-1|ABD18600.1| 168|Anopheles gambiae putative TIL domai... 22 7.8 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 22 7.8 AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase... 22 7.8 AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein p... 22 7.8 >DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domain polypeptide protein. Length = 194 Score = 22.2 bits (45), Expect = 7.8 Identities = 10/29 (34%), Positives = 12/29 (41%) Frame = +3 Query: 324 ENVQNCFTCAPNLCLNNGVCQEALTEHGY 410 E Q C T P C + +A T H Y Sbjct: 39 EEFQECGTACPKTCADLNDLPKACTLHVY 67 >DQ370039-1|ABD18600.1| 168|Anopheles gambiae putative TIL domain polypeptide protein. Length = 168 Score = 22.2 bits (45), Expect = 7.8 Identities = 9/26 (34%), Positives = 12/26 (46%) Frame = +3 Query: 324 ENVQNCFTCAPNLCLNNGVCQEALTE 401 E Q C T PN C + Q+ T+ Sbjct: 39 EEFQTCGTACPNTCADLNELQKPCTK 64 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 22.2 bits (45), Expect = 7.8 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -3 Query: 237 RGQLEAGQSQEHHQCKEVDSVLVPSIDPVTQQ*MVHCYRRPSL 109 R +LEA + + E +P+I P +Q V +RPSL Sbjct: 2956 REELEA-RRYDRDMSTETSKRDIPNIPPAPEQQPVRHQQRPSL 2997 >AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase subunit 1 protein. Length = 688 Score = 22.2 bits (45), Expect = 7.8 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -1 Query: 224 KLVKVRNTTNVKR-LIQF*YRPLIR*LSNK 138 KL KVRN TN + +++ Y +IR +N+ Sbjct: 252 KLKKVRNLTNYREPIVEGYYPKMIRSSNNR 281 >AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein protein. Length = 285 Score = 22.2 bits (45), Expect = 7.8 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 293 EEHHGSSSRERKC 331 ++H G +RERKC Sbjct: 242 DKHEGPCTRERKC 254 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 432,916 Number of Sequences: 2352 Number of extensions: 7660 Number of successful extensions: 18 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 34205040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -