BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_A21 (317 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory recept... 20 5.5 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 20 7.2 >AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory receptor candidate 20 protein. Length = 393 Score = 20.2 bits (40), Expect = 5.5 Identities = 9/39 (23%), Positives = 22/39 (56%) Frame = +1 Query: 64 FFIRDLKVYLQRV*RISMQTVRQLERGTNSLETVMKEHK 180 FF+R +++ ++ + + +++ G N +VMK +K Sbjct: 192 FFVRVIRLKIEDLNGAFRAGLERVQNGENQWISVMKVNK 230 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 19.8 bits (39), Expect = 7.2 Identities = 7/20 (35%), Positives = 10/20 (50%) Frame = +3 Query: 138 AWNKFIGDSNERTQNYKDFL 197 AW F+ RT+ YK + Sbjct: 536 AWRAFLAVLKRRTEIYKGLI 555 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 72,308 Number of Sequences: 336 Number of extensions: 1384 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 5942776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -