BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_A21 (317 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calc... 25 0.90 AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CY... 24 1.6 AY341174-1|AAR13738.1| 280|Anopheles gambiae fibrinogen protein. 23 3.6 AY341173-1|AAR13737.1| 280|Anopheles gambiae fibrinogen protein. 23 3.6 AY341172-1|AAR13736.1| 280|Anopheles gambiae fibrinogen protein. 23 3.6 AY341171-1|AAR13735.1| 280|Anopheles gambiae fibrinogen protein. 23 3.6 AY341170-1|AAR13734.1| 280|Anopheles gambiae fibrinogen protein. 23 3.6 AY341169-1|AAR13733.1| 280|Anopheles gambiae fibrinogen protein. 23 3.6 AY341168-1|AAR13732.1| 280|Anopheles gambiae fibrinogen protein. 23 3.6 DQ013245-1|AAY34441.1| 487|Anopheles gambiae adrenodoxin reduct... 22 4.8 DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 22 6.4 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 22 6.4 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 22 6.4 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 22 6.4 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 22 6.4 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 22 6.4 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 22 6.4 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 22 6.4 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 22 6.4 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 22 6.4 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 22 6.4 DQ370048-1|ABD18609.1| 144|Anopheles gambiae putative secreted ... 21 8.4 >EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calcium channel beta subunitprotein. Length = 466 Score = 24.6 bits (51), Expect = 0.90 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 147 CSTLELPYRLHTDPLHPLKVYLQISNEKL 61 C T+ P +L L P VYL+I++ K+ Sbjct: 335 CDTINHPSQLAKTSLAPTIVYLKIASSKV 363 >AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CYP12F1 protein. Length = 522 Score = 23.8 bits (49), Expect = 1.6 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -3 Query: 135 ELPYRLHTDPLHPLKVYLQISNEKLDPQTLFNL 37 +L YRL +P + L Y Q + KL Q L NL Sbjct: 243 DLMYRLEFEPEYVLWKYFQTPSLKLLMQELDNL 275 >AY341174-1|AAR13738.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 3.6 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +3 Query: 150 FIGDSNERTQNYKDFLIGLLKKHGCKKVLDGACGTGIDSM 269 F GD R YK+F IG + K L GTG DS+ Sbjct: 201 FAGDY--RYARYKEFEIGSEAEMYSLKKLGAYSGTGGDSL 238 >AY341173-1|AAR13737.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 3.6 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +3 Query: 150 FIGDSNERTQNYKDFLIGLLKKHGCKKVLDGACGTGIDSM 269 F GD R YK+F IG + K L GTG DS+ Sbjct: 201 FAGDY--RYARYKEFEIGSEAEMYSLKKLGAYSGTGGDSL 238 >AY341172-1|AAR13736.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 3.6 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +3 Query: 150 FIGDSNERTQNYKDFLIGLLKKHGCKKVLDGACGTGIDSM 269 F GD R YK+F IG + K L GTG DS+ Sbjct: 201 FAGDY--RYARYKEFEIGSEAEMYSLKKLGAYSGTGGDSL 238 >AY341171-1|AAR13735.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 3.6 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +3 Query: 150 FIGDSNERTQNYKDFLIGLLKKHGCKKVLDGACGTGIDSM 269 F GD R YK+F IG + K L GTG DS+ Sbjct: 201 FAGDY--RYARYKEFEIGSEAEMYSLKKLGAYSGTGGDSL 238 >AY341170-1|AAR13734.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 3.6 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +3 Query: 150 FIGDSNERTQNYKDFLIGLLKKHGCKKVLDGACGTGIDSM 269 F GD R YK+F IG + K L GTG DS+ Sbjct: 201 FAGDY--RYARYKEFEIGSEAEMYSLKKLGAYSGTGGDSL 238 >AY341169-1|AAR13733.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 3.6 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +3 Query: 150 FIGDSNERTQNYKDFLIGLLKKHGCKKVLDGACGTGIDSM 269 F GD R YK+F IG + K L GTG DS+ Sbjct: 201 FAGDY--RYARYKEFEIGSEAEMYSLKKLGAYSGTGGDSL 238 >AY341168-1|AAR13732.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 3.6 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +3 Query: 150 FIGDSNERTQNYKDFLIGLLKKHGCKKVLDGACGTGIDSM 269 F GD R YK+F IG + K L GTG DS+ Sbjct: 201 FAGDY--RYARYKEFEIGSEAEMYSLKKLGAYSGTGGDSL 238 >DQ013245-1|AAY34441.1| 487|Anopheles gambiae adrenodoxin reductase protein. Length = 487 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -2 Query: 274 SIMESIPVPQAPSSTFLHPCFFKSPM 197 S+ E P P+ P FF+SP+ Sbjct: 276 SLAEQAPNNVPPAGRCFQPIFFRSPV 301 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -2 Query: 283 SSTSIMESIPVPQAP 239 SS +MESIP P P Sbjct: 746 SSPPVMESIPPPPKP 760 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -1 Query: 272 HHGVNPCSASTVQHFLA 222 HHG S ST+QH A Sbjct: 24 HHGSIATSHSTIQHHAA 40 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -1 Query: 272 HHGVNPCSASTVQHFLA 222 HHG S ST+QH A Sbjct: 24 HHGSIATSHSTIQHHAA 40 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -1 Query: 272 HHGVNPCSASTVQHFLA 222 HHG S ST+QH A Sbjct: 24 HHGSIATSHSTIQHHAA 40 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -1 Query: 272 HHGVNPCSASTVQHFLA 222 HHG S ST+QH A Sbjct: 24 HHGSIATSHSTIQHHAA 40 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -1 Query: 272 HHGVNPCSASTVQHFLA 222 HHG S ST+QH A Sbjct: 24 HHGSIATSHSTIQHHAA 40 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -1 Query: 272 HHGVNPCSASTVQHFLA 222 HHG S ST+QH A Sbjct: 24 HHGSIATSHSTIQHHAA 40 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -1 Query: 272 HHGVNPCSASTVQHFLA 222 HHG S ST+QH A Sbjct: 24 HHGSIATSHSTIQHHAA 40 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -1 Query: 272 HHGVNPCSASTVQHFLA 222 HHG S ST+QH A Sbjct: 24 HHGSIATSHSTIQHHAA 40 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -1 Query: 272 HHGVNPCSASTVQHFLA 222 HHG S ST+QH A Sbjct: 24 HHGSIASSHSTIQHHAA 40 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -1 Query: 272 HHGVNPCSASTVQHFLA 222 HHG S ST+QH A Sbjct: 24 HHGSIATSHSTIQHHAA 40 >DQ370048-1|ABD18609.1| 144|Anopheles gambiae putative secreted polypeptide protein. Length = 144 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -2 Query: 274 SIMESIPVPQAPSSTFLHPC 215 + + IPV + +T LHPC Sbjct: 25 TFLAHIPVDVSTLTTTLHPC 44 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 331,194 Number of Sequences: 2352 Number of extensions: 6818 Number of successful extensions: 27 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 56 effective length of database: 432,267 effective search space used: 21181083 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -