BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_A21 (317 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g20020.1 68416.m02533 protein arginine N-methyltransferase fa... 31 0.17 At3g54930.1 68416.m06087 serine/threonine protein phosphatase 2A... 30 0.29 At3g12270.1 68416.m01532 protein arginine N-methyltransferase fa... 30 0.39 At3g24080.1 68416.m03024 KRR1 family protein contains Pfam PF051... 28 1.2 At3g23980.1 68416.m03012 dentin sialophosphoprotein-related cont... 27 2.1 At4g35560.1 68417.m05053 expressed protein 27 2.7 At3g61960.1 68416.m06959 protein kinase family protein contains ... 27 3.6 At1g16380.1 68414.m01959 cation/proton exchanger, putative (CHX1... 27 3.6 At3g44690.1 68416.m04806 expressed protein 26 4.8 At5g59710.1 68418.m07485 transcription regulator NOT2/NOT3/NOT5 ... 26 6.3 At3g10070.1 68416.m01207 transcription initiation factor IID (TF... 26 6.3 At2g29690.1 68415.m03609 anthranilate synthase, alpha subunit, c... 25 8.3 At1g76090.1 68414.m08836 S-adenosyl-methionine-sterol-C-methyltr... 25 8.3 >At3g20020.1 68416.m02533 protein arginine N-methyltransferase family protein similar to SP|Q96LA8 Protein arginine N-methyltransferase 6 (EC 2.1.1.-) {Homo sapiens} Length = 435 Score = 31.1 bits (67), Expect = 0.17 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +3 Query: 171 RTQNYKDFLIGLLKKHGCKKVLDGACGTGIDSMMLVDEGFNLV-SVDASD 317 RT+ Y++ ++ K V+D CGTGI S+ G V +VDASD Sbjct: 102 RTETYREAIMQHQSLIEGKVVVDVGCGTGILSIFCAQAGAKRVYAVDASD 151 >At3g54930.1 68416.m06087 serine/threonine protein phosphatase 2A (PP2A) regulatory subunit B', putative similar to SWISS-PROT:Q28653 serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, delta isoform (PP2A, B subunit, B' delta isoform, PP2A, B subunit, B56 delta isoform, PP2A, B subunit, PR61 delta isoform, PP2A, B subunit, R5 delta isoform, PP2A, B subunit, B'-gamma) [Oryctolagus cuniculus]; contains Pfam domain, PF01603: Protein phosphatase 2A regulatory B subunit (B56 family) Length = 497 Score = 30.3 bits (65), Expect = 0.29 Identities = 28/83 (33%), Positives = 40/83 (48%), Gaps = 2/83 (2%) Frame = -2 Query: 307 STETRLKPSSTSIMESIPVPQAPSSTFLHPCFFKSPMRKSL*FC--VLSLLSPMNLFHAR 134 S T PSS S ES Q+PS T HP F +P+ + L V S P+ LF + Sbjct: 39 SRTTTPAPSSVSNGESQTTAQSPSQTPNHPMFTTTPILEVLPLLKDVSSSDRPL-LFMKK 97 Query: 133 AALPSAY*SFTPSEGIPSDLE*K 65 A + S + F+ + +P + E K Sbjct: 98 AHMCSCHCDFSDTLIMPREKEIK 120 >At3g12270.1 68416.m01532 protein arginine N-methyltransferase family protein similar to protein arginine N-methyltransferase 3 from {Rattus norvegicus} SP|O70467, {Homo sapiens} SP|O60678 Length = 590 Score = 29.9 bits (64), Expect = 0.39 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = +3 Query: 171 RTQNYKDFLIGLLKKHGCKKVLDGACGTGIDSMMLVDEGFN-LVSVDASD 317 RT+ Y+D L+ V+D CGTGI S+ G + +V+V+AS+ Sbjct: 260 RTEAYRDALLKNPTLLNGSVVMDVGCGTGILSLFAAKAGASRVVAVEASE 309 >At3g24080.1 68416.m03024 KRR1 family protein contains Pfam PF05178: Krr1 family Length = 638 Score = 28.3 bits (60), Expect = 1.2 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Frame = +3 Query: 87 IPSEGVKDQYADGKAARAWNKFIGDSNERTQN--YKDFLIGLLKKHGCKKV 233 + EG D D + A+ +++ GD E T+N KD+L+ L K ++V Sbjct: 188 VEKEGDDDVEVDEELAKKMDEYYGDEAEATENQFLKDYLVKQLWKEKEERV 238 >At3g23980.1 68416.m03012 dentin sialophosphoprotein-related contains weak similarity to Dentin sialophosphoprotein precursor (Swiss-Prot:Q9NZW4) [Homo sapiens] Length = 736 Score = 27.5 bits (58), Expect = 2.1 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = -2 Query: 316 SEASTETRLKPSSTSIMESIPVPQAPSSTFLHP 218 + A +E +K S S ++S+ + +AP + + HP Sbjct: 249 NSAKSEATVKRSRPSFLDSLNISRAPETQYQHP 281 >At4g35560.1 68417.m05053 expressed protein Length = 917 Score = 27.1 bits (57), Expect = 2.7 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +3 Query: 75 RSEGIPSEGVKDQYADGKAARAWNKFIGDSNERTQ 179 +SE IP +K YA+GKA+R + IG S+ Q Sbjct: 132 KSEKIPIASLKWVYAEGKASRVY--VIGSSSNSLQ 164 >At3g61960.1 68416.m06959 protein kinase family protein contains eukaryotic protein kinase domain, INTERPRO:IPR000719 Length = 626 Score = 26.6 bits (56), Expect = 3.6 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +2 Query: 191 LPHRAFEKTRMQESAGRCLRNRD*LHDA 274 +PH +FEKTR +++ G+C N+ + D+ Sbjct: 326 MPHTSFEKTR-KDTEGQCSSNQSGVVDS 352 >At1g16380.1 68414.m01959 cation/proton exchanger, putative (CHX1) monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 785 Score = 26.6 bits (56), Expect = 3.6 Identities = 11/33 (33%), Positives = 23/33 (69%) Frame = -1 Query: 248 ASTVQHFLASVFFQKPDEEVFIILCSFITVSNE 150 + +VQH +A++FF PD+ + LC ++T +++ Sbjct: 607 SDSVQH-VAALFFGGPDDREALSLCKWLTNNSQ 638 >At3g44690.1 68416.m04806 expressed protein Length = 1176 Score = 26.2 bits (55), Expect = 4.8 Identities = 20/76 (26%), Positives = 32/76 (42%) Frame = +3 Query: 90 PSEGVKDQYADGKAARAWNKFIGDSNERTQNYKDFLIGLLKKHGCKKVLDGACGTGIDSM 269 PS D +G+ ARA + G ++ ++Y D+ G H + L GID Sbjct: 802 PSLNKSDILVNGEEARALERRRGSFDDGEESYMDYKRGDAYLHYESQQLKKDHDYGIDDR 861 Query: 270 MLVDEGFNLVSVDASD 317 + D + + VD D Sbjct: 862 IYRDVNSSDIIVDHGD 877 >At5g59710.1 68418.m07485 transcription regulator NOT2/NOT3/NOT5 family protein contains Pfam domain PF04153: NOT2 / NOT3 / NOT5 family Length = 556 Score = 25.8 bits (54), Expect = 6.3 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 6/48 (12%) Frame = +1 Query: 64 FFIRDLKVYLQRV*RISMQTVRQLERGT------NSLETVMKEHKIIK 189 F+ ++L+V+ RV ++ ERGT NS +TV KEH +IK Sbjct: 497 FYHKELRVWFFRVGEPLVRAATY-ERGTYEYLDPNSFKTVRKEHFVIK 543 >At3g10070.1 68416.m01207 transcription initiation factor IID (TFIID) subunit A family protein similar to hypothetical protein GB:CAB10099 [Schizosaccharomyces pombe]; contains Pfam profile PF03847: Transcription initiation factor TFIID subunit A Length = 539 Score = 25.8 bits (54), Expect = 6.3 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 286 PSSTSIMESIPVPQAPSSTFLHP 218 PS +S++ SIP AP S L+P Sbjct: 39 PSPSSVVSSIPSSPAPQSPSLNP 61 >At2g29690.1 68415.m03609 anthranilate synthase, alpha subunit, component I-2 (ASA2) identical to SP|P32069 Length = 621 Score = 25.4 bits (53), Expect = 8.3 Identities = 20/52 (38%), Positives = 24/52 (46%) Frame = -2 Query: 250 PQAPSSTFLHPCFFKSPMRKSL*FCVLSLLSPMNLFHARAALPSAY*SFTPS 95 P PS F P KSP SL +L++ L H LPS S+TPS Sbjct: 30 PHFPSLRF--PLSLKSPPATSL-----NLVAGSKLLHFSRRLPSIKCSYTPS 74 >At1g76090.1 68414.m08836 S-adenosyl-methionine-sterol-C-methyltransferase identical to S-adenosyl-methionine-sterol-C-methyltransferase GI:2246456 from [Arabidopsis thaliana] Length = 359 Score = 25.4 bits (53), Expect = 8.3 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = +3 Query: 168 ERTQNYKDFLIGLLKKHGCKKVLDGACGTG 257 + T+ +++ + L+K +K+LD CG G Sbjct: 106 DATRIHEEMAVDLIKVKPGQKILDAGCGVG 135 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,642,460 Number of Sequences: 28952 Number of extensions: 130055 Number of successful extensions: 428 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 425 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 428 length of database: 12,070,560 effective HSP length: 71 effective length of database: 10,014,968 effective search space used: 340508912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -