BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_A20 (475 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52861| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_3457| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_45116| Best HMM Match : EGF (HMM E-Value=0) 44 5e-05 SB_22953| Best HMM Match : EGF_2 (HMM E-Value=1.3e-14) 44 6e-05 SB_52863| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_12758| Best HMM Match : EGF (HMM E-Value=2.5e-15) 41 6e-04 SB_42006| Best HMM Match : EGF_2 (HMM E-Value=8.7e-05) 41 6e-04 SB_59202| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 8e-04 SB_15408| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_52148| Best HMM Match : EGF (HMM E-Value=0) 40 0.001 SB_35194| Best HMM Match : EGF_2 (HMM E-Value=0) 40 0.001 SB_58993| Best HMM Match : EGF_CA (HMM E-Value=0) 38 0.003 SB_51974| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_28492| Best HMM Match : EGF_CA (HMM E-Value=2.2e-15) 38 0.003 SB_8425| Best HMM Match : EGF (HMM E-Value=0) 38 0.004 SB_20112| Best HMM Match : EGF (HMM E-Value=0) 38 0.006 SB_15410| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_46409| Best HMM Match : EGF_2 (HMM E-Value=0.011) 37 0.007 SB_52147| Best HMM Match : EGF (HMM E-Value=0) 37 0.007 SB_26220| Best HMM Match : EGF_2 (HMM E-Value=0.011) 37 0.007 SB_58994| Best HMM Match : EGF_CA (HMM E-Value=2.3e-29) 36 0.013 SB_42661| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.013 SB_15082| Best HMM Match : EGF_CA (HMM E-Value=5.5e-12) 36 0.013 SB_23967| Best HMM Match : SRCR (HMM E-Value=5.4e-11) 36 0.013 SB_26267| Best HMM Match : TSP_C (HMM E-Value=0) 36 0.023 SB_32940| Best HMM Match : EGF (HMM E-Value=0) 36 0.023 SB_4052| Best HMM Match : EGF (HMM E-Value=7.2e-05) 36 0.023 SB_3772| Best HMM Match : EGF (HMM E-Value=6.3e-06) 35 0.030 SB_47132| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.030 SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) 35 0.040 SB_16934| Best HMM Match : Ldl_recept_b (HMM E-Value=1.7e-39) 34 0.052 SB_2045| Best HMM Match : EGF (HMM E-Value=0) 34 0.052 SB_58558| Best HMM Match : EGF (HMM E-Value=0) 34 0.069 SB_49765| Best HMM Match : EGF (HMM E-Value=0) 34 0.069 SB_18560| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.069 SB_6077| Best HMM Match : EGF (HMM E-Value=0) 34 0.069 SB_42659| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.092 SB_16748| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.092 SB_26085| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.12 SB_21309| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.12 SB_4760| Best HMM Match : EGF (HMM E-Value=8.29989e-42) 33 0.12 SB_786| Best HMM Match : EGF (HMM E-Value=0) 33 0.12 SB_33986| Best HMM Match : EGF_CA (HMM E-Value=3.5e-17) 33 0.12 SB_32754| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.12 SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.12 SB_6849| Best HMM Match : EGF_2 (HMM E-Value=9.3e-11) 33 0.16 SB_16910| Best HMM Match : EGF (HMM E-Value=0) 32 0.21 SB_47055| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.28 SB_5020| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.28 SB_20264| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.37 SB_53569| Best HMM Match : EGF_CA (HMM E-Value=0) 31 0.49 SB_47667| Best HMM Match : Ldl_recept_a (HMM E-Value=0) 31 0.49 SB_11375| Best HMM Match : EGF_CA (HMM E-Value=0) 31 0.49 SB_28221| Best HMM Match : eRF1_3 (HMM E-Value=8.7) 31 0.49 SB_40116| Best HMM Match : EGF (HMM E-Value=0) 31 0.65 SB_31961| Best HMM Match : EGF (HMM E-Value=0) 31 0.65 SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.65 SB_25956| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.65 SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.65 SB_49700| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.65 SB_16119| Best HMM Match : EGF (HMM E-Value=2e-20) 31 0.65 SB_11521| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.65 SB_7343| Best HMM Match : EGF (HMM E-Value=0) 31 0.65 SB_59784| Best HMM Match : EGF (HMM E-Value=0.0012) 30 0.85 SB_43565| Best HMM Match : EGF (HMM E-Value=2.8e-05) 30 0.85 SB_41418| Best HMM Match : EGF_CA (HMM E-Value=0) 30 0.85 SB_41134| Best HMM Match : EGF_CA (HMM E-Value=0) 30 0.85 SB_29802| Best HMM Match : Laminin_EGF (HMM E-Value=0) 30 0.85 SB_58882| Best HMM Match : EGF_CA (HMM E-Value=0) 30 0.85 SB_3108| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.85 SB_11257| Best HMM Match : GCC2_GCC3 (HMM E-Value=2.7e-11) 30 1.1 SB_5182| Best HMM Match : TSP_1 (HMM E-Value=1.1e-11) 30 1.1 SB_41898| Best HMM Match : EGF_CA (HMM E-Value=3.9e-14) 30 1.1 SB_40708| Best HMM Match : SRCR (HMM E-Value=0) 30 1.1 SB_33576| Best HMM Match : Pentaxin (HMM E-Value=1.3e-06) 30 1.1 SB_31541| Best HMM Match : EGF (HMM E-Value=0) 30 1.1 SB_46333| Best HMM Match : EGF (HMM E-Value=1.10001e-40) 29 1.5 SB_45709| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_41907| Best HMM Match : Reprolysin (HMM E-Value=9.2e-05) 29 1.5 SB_36411| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_23044| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_18417| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_11794| Best HMM Match : TNFR_c6 (HMM E-Value=1.4e-05) 29 1.5 SB_5000| Best HMM Match : EGF_CA (HMM E-Value=0) 29 2.0 SB_31262| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_19665| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_4238| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_64| Best HMM Match : Rho_N (HMM E-Value=1.8e-07) 29 2.0 SB_58902| Best HMM Match : TNFR_c6 (HMM E-Value=0.032) 29 2.6 SB_47176| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_55657| Best HMM Match : EGF_CA (HMM E-Value=0) 29 2.6 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_29649| Best HMM Match : Sushi (HMM E-Value=4.1e-18) 29 2.6 SB_5780| Best HMM Match : EGF_CA (HMM E-Value=0) 29 2.6 SB_52403| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_52319| Best HMM Match : Rho_N (HMM E-Value=1.8e-07) 28 3.4 SB_47942| Best HMM Match : TSP_1 (HMM E-Value=0) 28 3.4 SB_32721| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_30275| Best HMM Match : EGF_CA (HMM E-Value=1.3e-13) 28 3.4 SB_19455| Best HMM Match : Amino_oxidase (HMM E-Value=0.0003) 28 3.4 SB_7289| Best HMM Match : EGF_CA (HMM E-Value=0) 28 3.4 SB_5993| Best HMM Match : EGF_2 (HMM E-Value=9e-14) 28 3.4 SB_40275| Best HMM Match : Cadherin (HMM E-Value=0) 28 3.4 SB_37171| Best HMM Match : EGF (HMM E-Value=2.6e-15) 28 3.4 SB_52309| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_38935| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_28272| Best HMM Match : EGF (HMM E-Value=2.6e-15) 28 4.5 SB_39378| Best HMM Match : VWA (HMM E-Value=0) 28 4.5 SB_34310| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_17518| Best HMM Match : F5_F8_type_C (HMM E-Value=1e-29) 28 4.5 SB_41405| Best HMM Match : RVT_1 (HMM E-Value=0) 27 6.0 SB_40529| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_28495| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_9653| Best HMM Match : Retrotrans_gag (HMM E-Value=0.05) 27 6.0 SB_57101| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_18656| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_16935| Best HMM Match : Cadherin (HMM E-Value=0) 27 6.0 SB_9494| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_50338| Best HMM Match : TNFR_c6 (HMM E-Value=1.4e-05) 27 7.9 SB_47663| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_44915| Best HMM Match : VWA (HMM E-Value=0) 27 7.9 SB_43504| Best HMM Match : Urotensin_II (HMM E-Value=0.05) 27 7.9 SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) 27 7.9 SB_13163| Best HMM Match : VWA (HMM E-Value=2.3e-32) 27 7.9 SB_39781| Best HMM Match : cNMP_binding (HMM E-Value=2.2e-19) 27 7.9 SB_17371| Best HMM Match : EGF_CA (HMM E-Value=0.36) 27 7.9 SB_12742| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_6742| Best HMM Match : EGF_CA (HMM E-Value=5.40004e-41) 27 7.9 SB_4548| Best HMM Match : WD40 (HMM E-Value=6.7e-35) 27 7.9 >SB_52861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1487 Score = 52.8 bits (121), Expect = 1e-07 Identities = 19/42 (45%), Positives = 27/42 (64%) Frame = +3 Query: 204 QCVCNPGYSMDLTDRRCKPRCAGGCPNGLCSGPNLCICNMGY 329 +CVC PGY L+ + C P C GC NG C+ P++C C+ G+ Sbjct: 217 RCVCKPGYEQALSGQ-CVPVCTQGCVNGKCTSPDVCTCSFGW 257 Score = 37.1 bits (82), Expect = 0.007 Identities = 16/54 (29%), Positives = 25/54 (46%) Frame = +3 Query: 123 GHVNGQNTQRFPECSEPCINGVCTEGNQCVCNPGYSMDLTDRRCKPRCAGGCPN 284 G+ + Q P C++ C+NG CT + C C+ G++ C G C N Sbjct: 223 GYEQALSGQCVPVCTQGCVNGKCTSPDVCTCSFGWTGPNCSVECLCNGHGHCAN 276 >SB_3457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 848 Score = 46.0 bits (104), Expect = 2e-05 Identities = 20/59 (33%), Positives = 30/59 (50%) Frame = +3 Query: 162 CSEPCINGVCTEGNQCVCNPGYSMDLTDRRCKPRCAGGCPNGLCSGPNLCICNMGYHKD 338 C++ + C N+CVCNPGY+ D +C+P CP +C+C GY+ D Sbjct: 781 CNDCNRHATCV-ANECVCNPGYTGD--GHQCQPDTCDSCPPNSHCMRGVCVCGKGYYFD 836 Score = 35.5 bits (78), Expect = 0.023 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 4/58 (6%) Frame = +3 Query: 171 PCINGV-CTEGN---QCVCNPGYSMDLTDRRCKPRCAGGCPNGLCSGPNLCICNMGYH 332 PC+NG CT +C CN GYS + C N C+ C+C+ GY+ Sbjct: 580 PCLNGGHCTSAGDSYKCACNEGYSGTTCEVTLHTECMDCHVNAGCT-DGKCVCHSGYY 636 >SB_45116| Best HMM Match : EGF (HMM E-Value=0) Length = 2023 Score = 44.4 bits (100), Expect = 5e-05 Identities = 29/71 (40%), Positives = 36/71 (50%), Gaps = 10/71 (14%) Frame = +3 Query: 159 EC-SEPCING-VCTE---GNQCVCNPGYS-----MDLTDRRCKPRCAGGCPNGLCSGPNL 308 EC S PCING CT+ G C C PGY+ +D+ + P GG N L +G N Sbjct: 241 ECASNPCINGGTCTDMVNGYNCTCPPGYNGTTCEIDINECASNPCLNGGTCNDLVNGYN- 299 Query: 309 CICNMGYHKDT 341 C C GY+ T Sbjct: 300 CNCPPGYNGTT 310 Score = 41.5 bits (93), Expect = 3e-04 Identities = 30/81 (37%), Positives = 40/81 (49%), Gaps = 11/81 (13%) Frame = +3 Query: 132 NGQNTQ-RFPEC-SEPCING-VCTE---GNQCVCNPGYS-----MDLTDRRCKPRCAGGC 278 NG N + EC S PC NG CT+ G +CVCN GY+ +D+ + P GG Sbjct: 193 NGINCEIEINECDSGPCNNGGTCTDRVNGYECVCNAGYTGTRCEIDIDECASNPCINGGT 252 Query: 279 PNGLCSGPNLCICNMGYHKDT 341 + +G N C C GY+ T Sbjct: 253 CTDMVNGYN-CTCPPGYNGTT 272 Score = 40.7 bits (91), Expect = 6e-04 Identities = 23/55 (41%), Positives = 29/55 (52%), Gaps = 5/55 (9%) Frame = +3 Query: 159 EC-SEPCING-VCTE---GNQCVCNPGYSMDLTDRRCKPRCAGGCPNGLCSGPNL 308 EC S PCING CTE G +C C PGY+ + +PR CP+ PN+ Sbjct: 1225 ECASNPCINGGTCTELVNGFKCTCVPGYNGTRCEIVLRPRPPKDCPSRFEGHPNI 1279 Score = 36.3 bits (80), Expect = 0.013 Identities = 25/67 (37%), Positives = 32/67 (47%), Gaps = 10/67 (14%) Frame = +3 Query: 159 EC-SEPCING-VCTE---GNQCVCNPGYS-----MDLTDRRCKPRCAGGCPNGLCSGPNL 308 EC S PC+NG C + G C C PGY+ +D+ + P GG L +G N Sbjct: 279 ECASNPCLNGGTCNDLVNGYNCNCPPGYNGTTCEIDINECASNPCVNGGTCADLVNGFN- 337 Query: 309 CICNMGY 329 C C GY Sbjct: 338 CTCPPGY 344 Score = 35.5 bits (78), Expect = 0.023 Identities = 24/68 (35%), Positives = 32/68 (47%), Gaps = 10/68 (14%) Frame = +3 Query: 159 EC-SEPCING-VCTE---GNQCVCNPGYS-----MDLTDRRCKPRCAGGCPNGLCSGPNL 308 EC S PC+NG C + G C C PGY+ +D+ + GG L +G N Sbjct: 1073 ECASNPCLNGGTCNDLVNGYNCKCQPGYNGTTCEIDINECASNQCVNGGTCTDLVNGFN- 1131 Query: 309 CICNMGYH 332 C C GY+ Sbjct: 1132 CTCPPGYN 1139 >SB_22953| Best HMM Match : EGF_2 (HMM E-Value=1.3e-14) Length = 635 Score = 44.0 bits (99), Expect = 6e-05 Identities = 25/81 (30%), Positives = 33/81 (40%), Gaps = 9/81 (11%) Frame = +3 Query: 123 GHVNGQNTQRFPECSEPCINGVCTEGNQCVCNPGYSMDLTDRRC-----KPRCAGGCP-- 281 G N+ P CS+ C GVC + + C C+PGY D+ C C C Sbjct: 87 GWAQSGNSCPTPICSKGCAQGVCVKPDNCTCHPGYDGPSCDQACTLGRWDVNCNNTCECQ 146 Query: 282 -NGLC-SGPNLCICNMGYHKD 338 N C S +C C G+ D Sbjct: 147 NNSTCDSVQGICNCTSGWQGD 167 Score = 30.3 bits (65), Expect = 0.85 Identities = 20/71 (28%), Positives = 28/71 (39%), Gaps = 2/71 (2%) Frame = +3 Query: 162 CSEPCINGVCTEGNQ--CVCNPGYSMDLTDRRCKPRCAGGCPNGLCSGPNLCICNMGYHK 335 C PC +G + + C C G + D RC RC G C+ +C C K Sbjct: 212 CERPCDSGYYGDECKRVCQCMNGATCDHVTGRCDQRCPVGTYGFDCA--KVCAC-ADTEK 268 Query: 336 DTSVKGRAVCV 368 + V G C+ Sbjct: 269 CSVVSGECTCI 279 >SB_52863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 575 Score = 42.7 bits (96), Expect = 1e-04 Identities = 19/51 (37%), Positives = 26/51 (50%) Frame = +3 Query: 174 CINGVCTEGNQCVCNPGYSMDLTDRRCKPRCAGGCPNGLCSGPNLCICNMG 326 C+N T C+CNPGY+ D C C C +G C+ LC C++G Sbjct: 52 CVNTYGTY--HCICNPGYTGD-GKTACNKTCYPACVHGTCNSNYLCDCDLG 99 >SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4527 Score = 42.7 bits (96), Expect = 1e-04 Identities = 24/74 (32%), Positives = 31/74 (41%), Gaps = 10/74 (13%) Frame = +3 Query: 156 PECSEPCINGVCTEGNQCVCNPGYSMDLTDRRCK--PRCAGG---C--PNGLCS---GPN 305 P C C+ G QC+CNPGY +D C C G C G+C+ G Sbjct: 475 PPCDTLCVVADTDSGYQCLCNPGYHLDSDPHICSDIDECTSGSHTCAPSGGVCTNTMGSY 534 Query: 306 LCICNMGYHKDTSV 347 C C+ GY D + Sbjct: 535 TCACDSGYTGDGQI 548 >SB_12758| Best HMM Match : EGF (HMM E-Value=2.5e-15) Length = 165 Score = 40.7 bits (91), Expect = 6e-04 Identities = 22/58 (37%), Positives = 24/58 (41%), Gaps = 2/58 (3%) Frame = +3 Query: 162 CSEPCING-VCTEGNQCVCNPGYSMDLT-DRRCKPRCAGGCPNGLCSGPNLCICNMGY 329 C C NG C + C C GY L CKP C G G C G N C C G+ Sbjct: 100 CRNGCYNGGECVRPDVCKCRAGYEGPLCLTPVCKPSCVNG---GYCVGSNTCRCLRGF 154 Score = 37.5 bits (83), Expect = 0.006 Identities = 22/58 (37%), Positives = 26/58 (44%), Gaps = 2/58 (3%) Frame = +3 Query: 162 CSEPCINGV-CTEGNQCVCNPGYSMDLTDRRCKPRCAGGCPNG-LCSGPNLCICNMGY 329 C PC G+ C C C GY + RR C GC NG C P++C C GY Sbjct: 68 CDHPCPYGMTCVAPRTCRCPKGY-YGIGCRRAF--CRNGCYNGGECVRPDVCKCRAGY 122 >SB_42006| Best HMM Match : EGF_2 (HMM E-Value=8.7e-05) Length = 326 Score = 40.7 bits (91), Expect = 6e-04 Identities = 22/56 (39%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = +3 Query: 174 CINGVCTEGN-QCVCNPGYSMDLTDR-RCKPRC-AGGCPNGLCSGPNLCICNMGYH 332 C +G CT+ +C C+PG+ DL DR C C G CP+ PN C C Y+ Sbjct: 141 CAHGRCTKSRFRCECDPGWHGDLCDRAMCNVPCHFGACPH----DPNKCECYSNYY 192 >SB_59202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1530 Score = 40.3 bits (90), Expect = 8e-04 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = +3 Query: 150 RFPECSEPCINGVCTEGNQCVCNPGYSMDLTDRR-CKPRC--AGGCPNGLC 293 R C PC+NG +CVC G++ + + R C P C +G C NG C Sbjct: 270 RIAGCLYPCMNGGSCINGKCVCAVGFTGNTCEERLCDPPCQNSGTCNNGTC 320 Score = 39.9 bits (89), Expect = 0.001 Identities = 23/64 (35%), Positives = 27/64 (42%), Gaps = 8/64 (12%) Frame = +3 Query: 162 CSEPCIN-GVCTEGNQCVCNPGYS-------MDLTDRRCKPRCAGGCPNGLCSGPNLCIC 317 C PC N G C G C+C Y+ ++L C P C G G CS PN C C Sbjct: 305 CDPPCQNSGTCNNGT-CICTKQYTGKSCEHGINLVLSSCVPFCQNG---GTCSSPNTCKC 360 Query: 318 NMGY 329 Y Sbjct: 361 PFAY 364 >SB_15408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 779 Score = 39.9 bits (89), Expect = 0.001 Identities = 26/70 (37%), Positives = 31/70 (44%), Gaps = 13/70 (18%) Frame = +3 Query: 159 ECSEP--CINGVCTEGN---QCVCNPGYSMDLTDRRCKP--RC---AGGCPNGLC---SG 299 EC E C NG C N +C+CN GY + +C C C NG+C G Sbjct: 410 ECREKDVCKNGRCQNVNGAFRCICNKGYELSSDRTQCVDINECLTQGEMCRNGVCENTEG 469 Query: 300 PNLCICNMGY 329 CICN GY Sbjct: 470 SYRCICNAGY 479 Score = 38.7 bits (86), Expect = 0.002 Identities = 25/64 (39%), Positives = 29/64 (45%), Gaps = 12/64 (18%) Frame = +3 Query: 174 CINGVCTE---GNQCVCNPGYSMDL-TDRRC--KPRCAGG---CPNGLC---SGPNLCIC 317 C NG C + G +CVCN GY + D +C K C C NG C G C C Sbjct: 269 CPNGRCIDMPSGFRCVCNDGYILPTGRDNKCVDKNECEADSTLCTNGRCVNTEGSYKCTC 328 Query: 318 NMGY 329 N GY Sbjct: 329 NNGY 332 Score = 37.9 bits (84), Expect = 0.004 Identities = 25/69 (36%), Positives = 32/69 (46%), Gaps = 12/69 (17%) Frame = +3 Query: 159 ECSEP--CINGVCTE--GN-QCVCNPGYSMDLTDRRC----KPRCAGGCPNGLCSGPN-- 305 EC++ C NG C G+ C C G+++ L RC + R C NG C N Sbjct: 369 ECTDESVCTNGQCINNIGSFTCTCRRGFTLSLDRTRCDDMDECREKDVCKNGRCQNVNGA 428 Query: 306 -LCICNMGY 329 CICN GY Sbjct: 429 FRCICNKGY 437 Score = 35.9 bits (79), Expect = 0.017 Identities = 15/32 (46%), Positives = 22/32 (68%), Gaps = 3/32 (9%) Frame = +3 Query: 168 EPCINGVC--TEGN-QCVCNPGYSMDLTDRRC 254 E C NGVC TEG+ +C+CN GY+ + + +C Sbjct: 457 EMCRNGVCENTEGSYRCICNAGYAANAEENKC 488 Score = 33.9 bits (74), Expect = 0.069 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 3/34 (8%) Frame = +3 Query: 174 CINGVC--TEGN-QCVCNPGYSMDLTDRRCKPRC 266 C NG C TEG+ +C CN GY +RC RC Sbjct: 312 CTNGRCVNTEGSYKCTCNNGYKPSPDGKRCVGRC 345 >SB_52148| Best HMM Match : EGF (HMM E-Value=0) Length = 1055 Score = 39.5 bits (88), Expect = 0.001 Identities = 27/68 (39%), Positives = 31/68 (45%), Gaps = 10/68 (14%) Frame = +3 Query: 156 PEC-SEPCINGVCTEGNQ---CVCNPGY---SMDLTDRRCKPRCAGGCPNGLCSG---PN 305 P C PCING CTE N C C GY + + + CKP C NG C G + Sbjct: 310 PLCLPNPCINGNCTESNSSFTCECFSGYTGPTCAVVESACKPT---SCVNGECVGNGHNS 366 Query: 306 LCICNMGY 329 C C GY Sbjct: 367 SCKCWKGY 374 Score = 33.5 bits (73), Expect = 0.092 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 4/47 (8%) Frame = +3 Query: 165 SEPCINGVCTEGN----QCVCNPGYSMDLTDRRCKPRCAGGCPNGLC 293 S PCI+G C + +C+C+ G++ D R P + C +G C Sbjct: 1000 SNPCIHGNCLVRDDSSFECICHKGFTGTKCDIRVDPCASSPCAHGQC 1046 Score = 31.5 bits (68), Expect = 0.37 Identities = 24/84 (28%), Positives = 32/84 (38%), Gaps = 7/84 (8%) Frame = +3 Query: 99 NDLSSVQGGHVNGQNTQRFPEC-SEPCINGVCTEGNQ---CVCNPGYSMDLTDRRCKPRC 266 N + ++ G + Q C S PC++G C N C C GY L P Sbjct: 718 NCMVTLDGHRCARCSEQAMDPCESNPCVHGTCRPRNDSFTCQCFEGYIGRLC-TTADPCM 776 Query: 267 AGGCPNGLCSGPN---LCICNMGY 329 C +G C N C C+ GY Sbjct: 777 RLACVHGACVSSNGVVRCECSAGY 800 Score = 30.3 bits (65), Expect = 0.85 Identities = 17/62 (27%), Positives = 25/62 (40%), Gaps = 7/62 (11%) Frame = +3 Query: 165 SEPCINGVCTEGNQ---CVCNPGYSMDLTDRRCKPRCAGGCPNGLC----SGPNLCICNM 323 S PC+NGVC + C C G+ + + C +G C CIC+ Sbjct: 963 SNPCLNGVCVSTSSTYTCRCTVGFKGTRCEHAMNTCYSNPCIHGNCLVRDDSSFECICHK 1022 Query: 324 GY 329 G+ Sbjct: 1023 GF 1024 >SB_35194| Best HMM Match : EGF_2 (HMM E-Value=0) Length = 960 Score = 39.5 bits (88), Expect = 0.001 Identities = 24/70 (34%), Positives = 32/70 (45%), Gaps = 7/70 (10%) Frame = +3 Query: 174 CINGVCTE-GNQCVCNPGYSMDLTDRRCKPRCAGGCP-----NGLCSGPN-LCICNMGYH 332 CING C CVCN + D+ C C CP NG C+ C+C GYH Sbjct: 509 CINGSCDPVTGACVCNRRVTGQRCDKPCI-NCNSPCPKCYHSNGACNAATGKCVCLDGYH 567 Query: 333 KDTSVKGRAV 362 D+ ++ +V Sbjct: 568 GDSCLEACSV 577 Score = 34.3 bits (75), Expect = 0.052 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 4/58 (6%) Frame = +3 Query: 156 PECSEPCI---NGVCTEGN-QCVCNPGYSMDLTDRRCKPRCAGGCPNGLCSGPNLCIC 317 P C+ C NG C + +C C PG++ D RC+ RC G CS N C C Sbjct: 413 PGCTNTCQCSRNGECDAASGRCACAPGFTGD----RCESRCPKGYYGTNCS--NACTC 464 Score = 33.1 bits (72), Expect = 0.12 Identities = 20/61 (32%), Positives = 26/61 (42%), Gaps = 4/61 (6%) Frame = +3 Query: 171 PCINGVCTEGNQCVCNPGYSMDLTDRR-CKPR-CAGG--CPNGLCSGPNLCICNMGYHKD 338 P +G + C C PGY D C P C G C L +G +C C G+H + Sbjct: 105 PNQSGRIEKKESCYCLPGYHGDGCQHYGCTPNPCQNGGTCKQSLQNGSFVCACAPGFHGN 164 Query: 339 T 341 T Sbjct: 165 T 165 Score = 30.7 bits (66), Expect = 0.65 Identities = 25/81 (30%), Positives = 29/81 (35%) Frame = +3 Query: 135 GQNTQRFPECSEPCINGVCTEGNQCVCNPGYSMDLTDRRCKPRCAGGCPNGLCSGPNLCI 314 G N C N C CNPG+S R C C GG CS + C Sbjct: 455 GTNCSNACTCKATNTNVCDVTSGFCHCNPGWS----GRSCYQPCPGGSWGVNCS--SKCD 508 Query: 315 CNMGYHKDTSVKGRAVCVKRI 377 C G V G VC +R+ Sbjct: 509 CING--SCDPVTGACVCNRRV 527 Score = 29.1 bits (62), Expect = 2.0 Identities = 16/52 (30%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = +3 Query: 171 PCINGV-CTE-GNQCVCNPGYSMDLTDRRCKPRCAGGCPNGLCSGPNLCICN 320 PC+NG C C C+PG++ + C P G C+ N CN Sbjct: 328 PCMNGAECDRVSGVCSCSPGWTGPFCSKPCPPSLWGHNCAHPCNCTNGARCN 379 >SB_58993| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 541 Score = 38.3 bits (85), Expect = 0.003 Identities = 24/71 (33%), Positives = 30/71 (42%), Gaps = 12/71 (16%) Frame = +3 Query: 174 CINGVCTE---GNQCVCNPGYSMDLTDRRCKP--RCAGGCPNGLC-------SGPNLCIC 317 CING C G +C+CN GY + + R+C C G P +C G C C Sbjct: 469 CINGKCISIKGGFRCMCNVGYKLSMNGRKCYDINECEG--PTKVCQFDCKNTDGSYECSC 526 Query: 318 NMGYHKDTSVK 350 GY D K Sbjct: 527 PKGYQVDADKK 537 Score = 36.7 bits (81), Expect = 0.010 Identities = 22/64 (34%), Positives = 28/64 (43%), Gaps = 10/64 (15%) Frame = +3 Query: 132 NGQNTQRFPECSEP---CINGVCTE---GNQCVCNPGYSMDLTDRRCKPRCAGGC----P 281 +G+ EC E C NG C G C CNPGY +RC+ + G C Sbjct: 344 DGRTCTDINECQERRGLCRNGACVNIDGGYVCNCNPGYKRSKNGKRCEDQRKGLCFATVT 403 Query: 282 NGLC 293 +GLC Sbjct: 404 DGLC 407 >SB_51974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3474 Score = 38.3 bits (85), Expect = 0.003 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 2/58 (3%) Frame = +3 Query: 162 CSEPCINGVCTEGNQCVCNPGYSMDLTDRRC--KPRCAGGCPNGLCSGPNLCICNMGY 329 C++ C+N C C PGY D +RRC K C C N +G C C+ GY Sbjct: 406 CNDNCVN--LYGKYTCQCGPGYEFDWLNRRCCQKVSCFPRCSN--INGNYSCECSAGY 459 Score = 28.3 bits (60), Expect = 3.4 Identities = 20/64 (31%), Positives = 27/64 (42%), Gaps = 8/64 (12%) Frame = +3 Query: 162 CSEPCINGVCTEGNQCVCNPGYSMDLTDRRCK--PRCAGG---CPNGLCS---GPNLCIC 317 C++ C N C C PG+ + + D+ C CA G C N C G C C Sbjct: 596 CNQTCNN--VPGSYYCTCFPGFYLMMEDQSCVDIDECAAGFHQC-NQNCQNIPGSYNCTC 652 Query: 318 NMGY 329 +GY Sbjct: 653 GLGY 656 Score = 27.9 bits (59), Expect = 4.5 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 7/64 (10%) Frame = +3 Query: 162 CSEPCINGVCTEGNQCVCNPGYSMDLTDRRC--KPRCAGGCP--NGLCS---GPNLCICN 320 CS+ C N T C C GY++D R C C+ G + +C+ G C C+ Sbjct: 760 CSQGCKNLYGTFS--CFCYRGYALDSDKRTCIDVEECSSGAHGCSQICNNTQGSFHCGCH 817 Query: 321 MGYH 332 GY+ Sbjct: 818 QGYN 821 >SB_28492| Best HMM Match : EGF_CA (HMM E-Value=2.2e-15) Length = 89 Score = 38.3 bits (85), Expect = 0.003 Identities = 24/71 (33%), Positives = 30/71 (42%), Gaps = 12/71 (16%) Frame = +3 Query: 174 CINGVCTE---GNQCVCNPGYSMDLTDRRCKP--RCAGGCPNGLC-------SGPNLCIC 317 CING C G +C+CN GY + + R+C C G P +C G C C Sbjct: 17 CINGKCISIKGGFRCMCNVGYKLSMNGRKCYDINECEG--PTKVCQFDCKNTDGSYECSC 74 Query: 318 NMGYHKDTSVK 350 GY D K Sbjct: 75 PKGYQVDADKK 85 >SB_8425| Best HMM Match : EGF (HMM E-Value=0) Length = 1955 Score = 37.9 bits (84), Expect = 0.004 Identities = 22/69 (31%), Positives = 30/69 (43%), Gaps = 8/69 (11%) Frame = +3 Query: 159 ECSE-PCIN-GVCTE---GNQCVCNPGYSMDLTDRRCKPRCAGGCPNGLCSGP---NLCI 314 +C++ PC+N G C + G C C G++ DR C NG+C C Sbjct: 587 DCAKNPCLNNGACVDQVNGYTCTCKAGFAGSRCDRNVDNCYPNPCVNGVCKNKVNGYECA 646 Query: 315 CNMGYHKDT 341 CN GY T Sbjct: 647 CNPGYSGST 655 Score = 30.7 bits (66), Expect = 0.65 Identities = 24/79 (30%), Positives = 30/79 (37%), Gaps = 9/79 (11%) Frame = +3 Query: 120 GGHVNGQNTQRFPEC-SEPCING-VCTE---GNQCVCNPGYS---MDLTDRRC-KPRCAG 272 GG + EC S+PC G C + G +C+C GYS D+ C RC Sbjct: 460 GGFTGRRCETEQDECLSDPCYQGSTCIDKVNGYECICAAGYSGPNCDVISGLCSSSRCQN 519 Query: 273 GCPNGLCSGPNLCICNMGY 329 G C C GY Sbjct: 520 GAKCVAKPPSGACECPEGY 538 Score = 30.3 bits (65), Expect = 0.85 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Frame = +3 Query: 129 VNGQNTQRFPECSEPCINGVCTEGN-QCVCNPGYSMDLTDRRCKPRCAGGCP-NGLCS 296 +N N+ P C++ C N TEG+ C CNPGY++ C C G+CS Sbjct: 1201 INECNSASSP-CAQQCTN---TEGSFTCSCNPGYNLGSDGVTCND--VNECSLTGICS 1252 >SB_20112| Best HMM Match : EGF (HMM E-Value=0) Length = 2112 Score = 37.5 bits (83), Expect = 0.006 Identities = 25/67 (37%), Positives = 34/67 (50%), Gaps = 10/67 (14%) Frame = +3 Query: 159 EC-SEPCINGVCTEGN---QCVCNPGYSMDLTD---RRC--KPRCAGG-CPNGLCSGPNL 308 EC S PC++G+C + +C C+ GY+ L D C P GG C +GL G Sbjct: 303 ECESNPCVHGLCLDYQNKFECACSKGYTGRLCDVEINECDSNPCLNGGQCHDGL--GNYS 360 Query: 309 CICNMGY 329 C C +GY Sbjct: 361 CTCQVGY 367 Score = 31.5 bits (68), Expect = 0.37 Identities = 24/78 (30%), Positives = 32/78 (41%), Gaps = 10/78 (12%) Frame = +3 Query: 135 GQNTQ-RFPECSE-PCINGV-CTEGN----QCVCNPGYSMDLTDRRCKPRCAGGCPNGLC 293 G+N + R C + C NG C C C PGY+ + A C NG C Sbjct: 559 GKNCEVRIDSCIDHTCQNGASCVSSTPYAYSCQCKPGYTGQYCETDVDECAARPCVNGAC 618 Query: 294 -SGPN--LCICNMGYHKD 338 G N +C C+ G+ D Sbjct: 619 VDGVNGFICRCDPGFTGD 636 >SB_15410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1147 Score = 37.5 bits (83), Expect = 0.006 Identities = 26/71 (36%), Positives = 35/71 (49%), Gaps = 14/71 (19%) Frame = +3 Query: 159 ECSEP--CINGVCTE---GNQCVCNPGY--SMDLTD----RRC---KPRCAGGCPNGLCS 296 ECS+P C++G C G QC+CN G+ + D+ D C RC+ C N L Sbjct: 217 ECSDPGVCVHGRCENFNGGYQCICNRGFESTADMKDCVDINECLVDNGRCSEMCNNTL-- 274 Query: 297 GPNLCICNMGY 329 G LC C G+ Sbjct: 275 GSYLCDCGAGF 285 Score = 36.3 bits (80), Expect = 0.013 Identities = 23/63 (36%), Positives = 30/63 (47%), Gaps = 11/63 (17%) Frame = +3 Query: 174 CINGVCT--EGN-QCVCNPGYSMDLTDRRCK--PRC---AGGCPNGLCS---GPNLCICN 320 C NG C +G +C+CN GY + C+ C AG C NG C+ G C CN Sbjct: 100 CRNGRCVNKQGTFECICNQGYGLTADRMDCEDIDECSISAGLCGNGTCTNTPGAFRCDCN 159 Query: 321 MGY 329 G+ Sbjct: 160 PGF 162 Score = 32.3 bits (70), Expect = 0.21 Identities = 28/94 (29%), Positives = 35/94 (37%), Gaps = 15/94 (15%) Frame = +3 Query: 132 NGQNTQRFPECSE-PCING---VCTE---GNQCVCNPGYSMDLTDRRC--KPRCAGG--- 275 +G+ + EC E P + G C G C C GY + R C C Sbjct: 290 DGRTCRDIDECMERPDVCGPGNTCNNIEGGYYCTCGKGYKQSVDSRSCIDVDECQEDPRL 349 Query: 276 CPNGLC---SGPNLCICNMGYHKDTSVKGRAVCV 368 C NG+C G C+C GY KG CV Sbjct: 350 CTNGVCRNTPGSFECLCAKGY---AIAKGTTACV 380 Score = 27.5 bits (58), Expect = 6.0 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 6/47 (12%) Frame = +3 Query: 132 NGQNTQRFPECSE-P--CINGVCTE--GN-QCVCNPGYSMDLTDRRC 254 NG+ Q EC+E P C +G C G +C+CN G+ + C Sbjct: 574 NGKGCQDINECTEFPDLCHHGTCENLPGMFRCICNKGFQLTRLGSNC 620 >SB_46409| Best HMM Match : EGF_2 (HMM E-Value=0.011) Length = 323 Score = 37.1 bits (82), Expect = 0.007 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +3 Query: 132 NGQNTQRFPECSEPCINGVCTEGNQCVCNPGY 227 NG+ + C PC++G+CT + C+C+ G+ Sbjct: 224 NGKRLRHKDFCDPPCVHGMCTSDDNCMCDRGF 255 Score = 27.1 bits (57), Expect = 7.9 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +3 Query: 249 RCKPRCAGGCPNGLCSGPNLCICNMGY 329 R K C C +G+C+ + C+C+ G+ Sbjct: 229 RHKDFCDPPCVHGMCTSDDNCMCDRGF 255 >SB_52147| Best HMM Match : EGF (HMM E-Value=0) Length = 364 Score = 37.1 bits (82), Expect = 0.007 Identities = 20/64 (31%), Positives = 27/64 (42%), Gaps = 6/64 (9%) Frame = +3 Query: 156 PECSEPCINGVCTEGN---QCVCNPGYSMDLTDRRCKPRCAGGCPNGLC---SGPNLCIC 317 P PC+NG C N +CVC+ GY+ D + + C NG C +C C Sbjct: 62 PCALHPCVNGDCISSNDTFRCVCSEGYTGDRCETVVDMCISAPCHNGTCINYGSSYICDC 121 Query: 318 NMGY 329 Y Sbjct: 122 FNSY 125 Score = 36.7 bits (81), Expect = 0.010 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 6/64 (9%) Frame = +3 Query: 165 SEPCINGVCTE---GNQCVCNPGYSMDLTDRRCKPRCAGGCPNGLCSGPN---LCICNMG 326 S PC G C + C+C+ G++ L + P C NG C N C+C+ G Sbjct: 28 SSPCKYGKCVNYAGSHGCMCDSGFTGKLCENAQDPCALHPCVNGDCISSNDTFRCVCSEG 87 Query: 327 YHKD 338 Y D Sbjct: 88 YTGD 91 >SB_26220| Best HMM Match : EGF_2 (HMM E-Value=0.011) Length = 353 Score = 37.1 bits (82), Expect = 0.007 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +3 Query: 132 NGQNTQRFPECSEPCINGVCTEGNQCVCNPGY 227 NG+ + C PC++G+CT + C+C+ G+ Sbjct: 235 NGKRLRHKDFCDPPCVHGMCTSDDNCMCDRGF 266 Score = 27.1 bits (57), Expect = 7.9 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +3 Query: 249 RCKPRCAGGCPNGLCSGPNLCICNMGY 329 R K C C +G+C+ + C+C+ G+ Sbjct: 240 RHKDFCDPPCVHGMCTSDDNCMCDRGF 266 >SB_58994| Best HMM Match : EGF_CA (HMM E-Value=2.3e-29) Length = 309 Score = 36.3 bits (80), Expect = 0.013 Identities = 25/70 (35%), Positives = 30/70 (42%), Gaps = 13/70 (18%) Frame = +3 Query: 159 ECSEP--CINGVCTEGN---QCVCNPGYSMDLTDRRC--KPRC---AGGCPNGLC---SG 299 EC P C +G+C N CVCN GY + R C C G C NG C G Sbjct: 175 ECGTPGYCDHGMCKNMNGSFSCVCNQGYHLTDNKRTCVDMNECILGKGLCGNGTCINTEG 234 Query: 300 PNLCICNMGY 329 C C+ G+ Sbjct: 235 SYRCECHPGF 244 Score = 32.7 bits (71), Expect = 0.16 Identities = 26/83 (31%), Positives = 36/83 (43%), Gaps = 10/83 (12%) Frame = +3 Query: 60 PNQPDHHITPNRTNDLSSV--QGGHV--NGQNTQRFPEC---SEPCINGVC--TEGN-QC 209 P DH + N S V QG H+ N + EC C NG C TEG+ +C Sbjct: 179 PGYCDHGMCKNMNGSFSCVCNQGYHLTDNKRTCVDMNECILGKGLCGNGTCINTEGSYRC 238 Query: 210 VCNPGYSMDLTDRRCKPRCAGGC 278 C+PG+ ++ + GGC Sbjct: 239 ECHPGFKLNRGGFCQETSATGGC 261 Score = 29.9 bits (64), Expect = 1.1 Identities = 11/24 (45%), Positives = 14/24 (58%), Gaps = 3/24 (12%) Frame = +3 Query: 270 GGCPNGLCSGPN---LCICNMGYH 332 G C +G+C N C+CN GYH Sbjct: 180 GYCDHGMCKNMNGSFSCVCNQGYH 203 >SB_42661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1717 Score = 36.3 bits (80), Expect = 0.013 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = +3 Query: 156 PECSEPCINGVCTEGNQCVCNPGYSMDLTDRRCKPRCA--GGCPNGLC 293 P C++PC++G G+ CVC+P Y T C+ C+ G C G C Sbjct: 1493 PACNDPCVHGREVAGS-CVCDPCY----TGSGCQSECSGHGECVEGKC 1535 Score = 27.5 bits (58), Expect = 6.0 Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 6/52 (11%) Frame = +3 Query: 180 NGVCT-EGNQCVCNPGYSMDLTDR-RC--KPRCAGGCPNGLCS--GPNLCIC 317 NG C + +C C PG++ D D+ C P C+G G CS P C C Sbjct: 1565 NGFCNLKLQKCECYPGWAGDACDKLDCPGSPPCSG---QGECSNTNPRRCQC 1613 >SB_15082| Best HMM Match : EGF_CA (HMM E-Value=5.5e-12) Length = 125 Score = 36.3 bits (80), Expect = 0.013 Identities = 35/113 (30%), Positives = 48/113 (42%), Gaps = 15/113 (13%) Frame = +3 Query: 177 INGVCTEGNQ---CVCNPGYSMD---LTD-RRCKPRCAGGCPNGLCS---GPNLCICNMG 326 IN VCT + CVCNPGY + +D C PN C+ G C C G Sbjct: 12 INAVCTMKHDQYACVCNPGYRGNGHLCSDIDECGENVHACSPNATCTNTVGSFSCSCQSG 71 Query: 327 YHKDTSVKGRAVCVKRIRRSLNYFLS-----KKLKSII*FVSMYVSSLVIFCL 470 +H D G V R R +L + +++K I+ S +V V+ CL Sbjct: 72 FHGD----GFKCVVDRTRSTLQRIVDQLSNRERIKEIVGITSGFV---VVICL 117 >SB_23967| Best HMM Match : SRCR (HMM E-Value=5.4e-11) Length = 3369 Score = 36.3 bits (80), Expect = 0.013 Identities = 30/107 (28%), Positives = 45/107 (42%), Gaps = 8/107 (7%) Frame = +3 Query: 33 PDPFYQPHKPNQPDHH----ITPNRTNDLSSVQGGHVNGQNTQRFPECSEPCI-NGVCTE 197 P P + ++ + P H TP+ S Q + G + C C NG C Sbjct: 2207 PVPVWVLNETDTPSGHALRLFTPDGRVKSVSNQSLYPFGCSRSAVVRCPNGCFHNGDCI- 2265 Query: 198 GNQCVCNPGYS-MDLTDRRCKP--RCAGGCPNGLCSGPNLCICNMGY 329 G+ C C G++ D + C+ C+G G C GPN+C C G+ Sbjct: 2266 GSTCFCYRGWTGHDCSQFHCRDVHECSGF---GTCVGPNVCKCMTGF 2309 >SB_26267| Best HMM Match : TSP_C (HMM E-Value=0) Length = 2996 Score = 35.5 bits (78), Expect = 0.023 Identities = 26/74 (35%), Positives = 31/74 (41%), Gaps = 4/74 (5%) Frame = +3 Query: 141 NTQRFPECSEPCING-VCTEGNQCVCNPGYSMDLTDRRCKPRCAGGCPNGLCSGPNLCIC 317 N+ P+ PC G VC EG + C PG D T CK +C G N + C Sbjct: 1490 NSTWCPDNCYPCEKGTVCFEGKKYDCTPGTYSDGTGFPCK-QCDPGSFNNKSKADSCQCC 1548 Query: 318 NMGY---HKDTSVK 350 GY H TS K Sbjct: 1549 PNGYSSTHMKTSCK 1562 >SB_32940| Best HMM Match : EGF (HMM E-Value=0) Length = 1025 Score = 35.5 bits (78), Expect = 0.023 Identities = 25/75 (33%), Positives = 38/75 (50%), Gaps = 7/75 (9%) Frame = +3 Query: 90 NRTNDLSSVQGGHVNGQNTQRFPEC-SEPCINGVC---TEGN-QCVCNPGYS-MDLTDRR 251 N TN L G+ + R +C + PC+NG+C + GN +C C PG++ D+ + Sbjct: 67 NGTNFLCDCPQGYRGDRCEVRPGQCITNPCVNGICELDSLGNPRCFCIPGFAGSDIDEDE 126 Query: 252 CKPRCAGGCPN-GLC 293 C + C N GLC Sbjct: 127 C---ASSPCRNGGLC 138 Score = 28.3 bits (60), Expect = 3.4 Identities = 19/61 (31%), Positives = 24/61 (39%), Gaps = 8/61 (13%) Frame = +3 Query: 171 PCING-VCTEGNQ---CVCNPGYSMDLTDRRCKPRCAGGCPNGLCS----GPNLCICNMG 326 PC NG +C+ C C GY D + R C NG+C G C C G Sbjct: 57 PCTNGGLCSVNGTNFLCDCPQGYRGDRCEVRPGQCITNPCVNGICELDSLGNPRCFCIPG 116 Query: 327 Y 329 + Sbjct: 117 F 117 Score = 27.5 bits (58), Expect = 6.0 Identities = 17/51 (33%), Positives = 24/51 (47%) Frame = +3 Query: 159 ECSEPCINGVCTEGNQCVCNPGYSMDLTDRRCKPRCAGGCPNGLCSGPNLC 311 +C EP + C+ QCV N +SM + +CK C GG C + C Sbjct: 317 KCIEPGSSVYCSNHGQCVTN--FSM--SSYQCK--CCGGFRGEFCEKEDHC 361 >SB_4052| Best HMM Match : EGF (HMM E-Value=7.2e-05) Length = 117 Score = 35.5 bits (78), Expect = 0.023 Identities = 26/90 (28%), Positives = 43/90 (47%), Gaps = 1/90 (1%) Frame = +3 Query: 159 ECSEPCINGVCTEGNQCVCNPGYSMDLTDRRCKPRCAGGC-PNGLCSGPNLCICNMGYHK 335 +C+ N C + +C+C G+S D T R C GC +G C CIC+ ++ Sbjct: 6 DCNGCHHNAKCVK-KECICKAGFSGDGTTCRV-DNCVNGCSKHGKCI-RGFCICDHSHYF 62 Query: 336 DTSVKGRAVCVKRIRRSLNYFLSKKLKSII 425 + + R + RI RS L+ L+S++ Sbjct: 63 NGAECARGL---RIGRSSASSLTDSLRSVV 89 >SB_3772| Best HMM Match : EGF (HMM E-Value=6.3e-06) Length = 519 Score = 35.1 bits (77), Expect = 0.030 Identities = 20/59 (33%), Positives = 26/59 (44%), Gaps = 2/59 (3%) Frame = +3 Query: 87 PNRTNDLSSVQGGHVNGQNTQRFP-ECSEPCING-VCTEGNQCVCNPGYSMDLTDRRCK 257 P + L ++Q N Q P +C PC+NG C N C C GY T RC+ Sbjct: 463 PPSSQCLQALQTSEEKPCNLQECPAQCGLPCLNGGSCVSRNTCACKKGY----TGERCE 517 >SB_47132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 35.1 bits (77), Expect = 0.030 Identities = 23/64 (35%), Positives = 28/64 (43%), Gaps = 9/64 (14%) Frame = +3 Query: 165 SEPCINGVCTE---GNQCVCNPGYSMDLTDRRCKPRCA---GGCPNGLC---SGPNLCIC 317 S PC G C E G C+C PGYS + P C+ C NG+C G C C Sbjct: 29 SNPCTLGACMESPSGYYCICPPGYSGAGCRTQISP-CSPDVNPCVNGICKSVGGEIRCTC 87 Query: 318 NMGY 329 G+ Sbjct: 88 PGGW 91 >SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1327 Score = 34.7 bits (76), Expect = 0.040 Identities = 22/61 (36%), Positives = 26/61 (42%), Gaps = 3/61 (4%) Frame = +3 Query: 162 CSEPCINGVCTEGN-QCVCNPGYSMDLTDRRC--KPRCAGGCPNGLCSGPNLCICNMGYH 332 C CIN TEG QC C PGY R C CAG +G+C C G + Sbjct: 346 CQYQCIN---TEGGYQCKCPPGYRTSPDGRTCMDDDECAGS--DGVCQRDEQCFNTKGSY 400 Query: 333 K 335 + Sbjct: 401 R 401 >SB_16934| Best HMM Match : Ldl_recept_b (HMM E-Value=1.7e-39) Length = 407 Score = 34.3 bits (75), Expect = 0.052 Identities = 22/64 (34%), Positives = 29/64 (45%), Gaps = 8/64 (12%) Frame = +3 Query: 162 CSEPCINGVCTEGNQCVCNPGYSMDLTDRRCKP--RCA---GGCPNGLCS---GPNLCIC 317 CS C+N + G C+C PG+ + L R C C GGC +C+ G C C Sbjct: 336 CSHTCLNLI--GGYSCLCPPGFELSLDKRTCTDINECGYNRGGC-GQICTNSLGSYNCSC 392 Query: 318 NMGY 329 GY Sbjct: 393 LNGY 396 >SB_2045| Best HMM Match : EGF (HMM E-Value=0) Length = 1101 Score = 34.3 bits (75), Expect = 0.052 Identities = 19/54 (35%), Positives = 23/54 (42%), Gaps = 5/54 (9%) Frame = +3 Query: 183 GVCTEGNQCVCNPGYSMDLTDRRCKPRCAGGCPN-GLC--SGPNL--CICNMGY 329 G C GN CVC P + D D+ C N G C +GP+ C C Y Sbjct: 405 GTCVRGNDCVCKPDWQGDNCDQDLNKCRYSPCQNEGTCLNTGPDAYSCACKYKY 458 Score = 29.9 bits (64), Expect = 1.1 Identities = 11/23 (47%), Positives = 16/23 (69%), Gaps = 3/23 (13%) Frame = +3 Query: 171 PCINGVCTEGNQ---CVCNPGYS 230 PCI+G CT+ C+CNPG++ Sbjct: 959 PCISGNCTDTGTNFTCLCNPGFT 981 Score = 27.9 bits (59), Expect = 4.5 Identities = 21/58 (36%), Positives = 25/58 (43%), Gaps = 9/58 (15%) Frame = +3 Query: 183 GVCTEGNQ---CVCNPGYSMDLTDRRCKPRCAGG--CPNG-LC-SGPN--LCICNMGY 329 G C +G CVCN GY+ D A G C NG C G N C C +G+ Sbjct: 640 GTCKDGINDFSCVCNTGYTGAKCDSNIDDCAASGQPCQNGATCKDGVNQYTCECPLGF 697 >SB_58558| Best HMM Match : EGF (HMM E-Value=0) Length = 1101 Score = 33.9 bits (74), Expect = 0.069 Identities = 23/64 (35%), Positives = 31/64 (48%), Gaps = 8/64 (12%) Frame = +3 Query: 171 PCING-VCTE---GNQCVCNPGYSMDLTDRRCKPRCAGGCPNG-LC-SGPN--LCICNMG 326 PC+NG CT+ G C C PGY+ + ++ + C NG C G N CIC G Sbjct: 549 PCLNGGSCTDRVNGYTCACAPGYTGNNCEKDIDDCASTPCMNGATCLDGVNSYTCICVTG 608 Query: 327 YHKD 338 + D Sbjct: 609 WTGD 612 Score = 28.3 bits (60), Expect = 3.4 Identities = 18/57 (31%), Positives = 25/57 (43%), Gaps = 5/57 (8%) Frame = +3 Query: 174 CINGVCTEGNQCVCNPGYSMDLTDRRCKPRCAGGCPNG-----LCSGPNLCICNMGY 329 C++GV G +C C PGY+ + C NG L +G + C C GY Sbjct: 289 CVDGV--NGYKCSCAPGYTGSNCETDINECAVNSCQNGGNCTDLVNGFS-CTCAPGY 342 >SB_49765| Best HMM Match : EGF (HMM E-Value=0) Length = 508 Score = 33.9 bits (74), Expect = 0.069 Identities = 31/87 (35%), Positives = 41/87 (47%), Gaps = 17/87 (19%) Frame = +3 Query: 138 QNTQRFPECSEPCING-VCT---EGNQ--CVCNPGYSMDLTDR--RCKPRCAGGCPN-GL 290 ++T P S PC NG VC +G C C+PGY+ D KP + C N G+ Sbjct: 113 EDTVTRPCVSSPCSNGSVCNNTQDGKNYTCTCSPGYTGRHCDTVIPLKPCDSSPCSNGGV 172 Query: 291 CS----GPN-LCICNMGY---HKDTSV 347 C+ G N C C+ GY H DT + Sbjct: 173 CNNTQDGKNYTCTCSPGYTGRHCDTVI 199 Score = 33.1 bits (72), Expect = 0.12 Identities = 28/77 (36%), Positives = 35/77 (45%), Gaps = 16/77 (20%) Frame = +3 Query: 165 SEPCING-VCT---EGNQ--CVCNPGYSMDLTDRRCKPRCAGG-CPNG-LCS----GPN- 305 S PC NG VC +G C C+PGY+ D C C NG +C+ G N Sbjct: 205 SSPCNNGSVCNNTQDGKNYTCTCSPGYTGRHCDTVIPKACVSSPCSNGSICNNTQDGKNY 264 Query: 306 LCICNMGY---HKDTSV 347 C C+ GY H DT + Sbjct: 265 TCTCSPGYTGRHCDTGM 281 >SB_18560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1937 Score = 33.9 bits (74), Expect = 0.069 Identities = 22/52 (42%), Positives = 24/52 (46%), Gaps = 8/52 (15%) Frame = +3 Query: 198 GNQCVCNPGYSMDLTDRRCKPRCAG-GC-PNGLC-----SGPN-LCICNMGY 329 G +CVCNPGY D C G C PN C SG N C CN G+ Sbjct: 1221 GTRCVCNPGYLGDGRKCTADGTCEGVKCDPNAKCIAASPSGENRTCACNDGF 1272 Score = 32.3 bits (70), Expect = 0.21 Identities = 18/63 (28%), Positives = 26/63 (41%), Gaps = 9/63 (14%) Frame = +3 Query: 168 EPCINGVCTEGNQCV---------CNPGYSMDLTDRRCKPRCAGGCPNGLCSGPNLCICN 320 + C+ G C + +CV CNPGY + +C+ C G C N C C Sbjct: 1368 DECLKGPCPQNAKCVNNFGSYLCICNPGYKK--VNGKCEKLCIRCMNGGSCVENNGCECP 1425 Query: 321 MGY 329 G+ Sbjct: 1426 KGF 1428 Score = 31.9 bits (69), Expect = 0.28 Identities = 29/87 (33%), Positives = 39/87 (44%), Gaps = 16/87 (18%) Frame = +3 Query: 117 QGGHVNGQNTQRFPECSE--PC--INGVCT--EGN-QCVCNPGYSMDLTDRRCKP--RCA 269 +G NG++ + EC + C + VCT EG+ C C PGY D R C P C Sbjct: 863 RGYQGNGEDCKDINECEQNHECDPLKAVCTNTEGSYSCTCRPGYGGD--GRTCTPISSCG 920 Query: 270 GG-CPN-GLC-----SGPNLCICNMGY 329 G C G C +G C C +G+ Sbjct: 921 GEVCHQFGECVTDDDTGRKRCQCRVGF 947 Score = 30.7 bits (66), Expect = 0.65 Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 5/60 (8%) Frame = +3 Query: 207 CVCNPGYSMDLTDRRCKPRCAGG-CP-NGLCS---GPNLCICNMGYHKDTSVKGRAVCVK 371 C C G+ D + C G CP N C G LCICN GY K + K +C++ Sbjct: 1351 CRCKEGFEGDGIICTDQDECLKGPCPQNAKCVNNFGSYLCICNPGY-KKVNGKCEKLCIR 1409 >SB_6077| Best HMM Match : EGF (HMM E-Value=0) Length = 1165 Score = 33.9 bits (74), Expect = 0.069 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 9/69 (13%) Frame = +3 Query: 159 ECS-EPCINGV-CTE---GNQCVCNPGYSMDLTDRRCKPRCAGGCPN-GLC---SGPNLC 311 EC+ PC+N CT+ G +C C GY+ +R + C N GLC + C Sbjct: 636 ECATSPCLNEAKCTDVVSGYRCTCRSGYTGTRCERDIDECSSSPCVNGGLCVDYTNYFEC 695 Query: 312 ICNMGYHKD 338 +C+ GY D Sbjct: 696 LCHPGYGGD 704 Score = 31.9 bits (69), Expect = 0.28 Identities = 26/74 (35%), Positives = 36/74 (48%), Gaps = 11/74 (14%) Frame = +3 Query: 159 EC-SEPCING-VCTEG---NQCVCNPGYS-----MDLTDRRCKPRCAGGCPNGLCSGPNL 308 EC S PC +G C +G QC+C PGY+ +D+ + +P G L S + Sbjct: 332 ECQSNPCQHGSACMDGVSSYQCICQPGYTGQYCHIDIDECLSRPCLNNGMCLDLVSDFH- 390 Query: 309 CICNMGYH-KDTSV 347 C C G+ KD SV Sbjct: 391 CTCPTGFSGKDCSV 404 Score = 29.1 bits (62), Expect = 2.0 Identities = 18/58 (31%), Positives = 23/58 (39%), Gaps = 6/58 (10%) Frame = +3 Query: 132 NGQNTQ-RFPEC-SEPCINGVCTEGN----QCVCNPGYSMDLTDRRCKPRCAGGCPNG 287 +G+N Q EC S PC NG E +C C PG+ + C NG Sbjct: 246 SGENCQVNIDECASSPCKNGATCEDLVDEFRCQCQPGFKGQNCETNINECIGAACANG 303 >SB_42659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5834 Score = 33.5 bits (73), Expect = 0.092 Identities = 21/52 (40%), Positives = 23/52 (44%) Frame = +3 Query: 156 PECSEPCINGVCTEGNQCVCNPGYSMDLTDRRCKPRCAGGCPNGLCSGPNLC 311 PEC C G + CVC+ GY TD C C GG N CS LC Sbjct: 4233 PECLRQCFYGNKMLPSSCVCHHGYWG--TD--CSMVCPGGAANP-CSNHGLC 4279 Score = 29.9 bits (64), Expect = 1.1 Identities = 19/67 (28%), Positives = 28/67 (41%) Frame = +3 Query: 129 VNGQNTQRFPECSEPCINGVCTEGNQCVCNPGYSMDLTDRRCKPRCAGGCPNGLCSGPNL 308 +N N C PCI+G N +C C C+G +G C+G + Sbjct: 267 INCTNNTMGAACELPCIHGNEFPPNSAICR--CEACYQGLACDVECSG---HGKCNGSH- 320 Query: 309 CICNMGY 329 CIC+ G+ Sbjct: 321 CICDEGH 327 Score = 29.5 bits (63), Expect = 1.5 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 9/59 (15%) Frame = +3 Query: 180 NGVCTEGNQCVCNPGYSMDLTDRRCK-PRCAGG--C-PNGLCSG----PNLCI-CNMGY 329 +G C +C C+PG+ C P C GG C +G+C G P +C+ C+ GY Sbjct: 90 HGSCLADGKCYCDPGWK----GVGCHIPHCPGGGDCNGHGVCDGVTHNPPVCVTCDPGY 144 >SB_16748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 33.5 bits (73), Expect = 0.092 Identities = 23/66 (34%), Positives = 30/66 (45%), Gaps = 9/66 (13%) Frame = +3 Query: 159 ECS-EPCING-VCTEGNQ---CVCNPGYSMDLTDRRCKPRCAGGCPNG-LCS-GPN--LC 311 EC+ +PC NG CT+G C C GY+ D + C NG C+ G N C Sbjct: 207 ECAGDPCANGGTCTDGINGFTCTCPAGYNGSTCDNDIDECASNPCQNGATCNDGVNSYTC 266 Query: 312 ICNMGY 329 C G+ Sbjct: 267 SCKPGF 272 >SB_26085| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 484 Score = 33.1 bits (72), Expect = 0.12 Identities = 24/62 (38%), Positives = 27/62 (43%), Gaps = 11/62 (17%) Frame = +3 Query: 180 NGVCT---EGNQCVCNPGYSMDLTDRRC--KPRCAGG--CPNGL-C---SGPNLCICNMG 326 + VCT +G C C GY MD C CA G CP+G C G C C G Sbjct: 297 HSVCTNHVKGFTCECESGYLMDDLKAHCIDVDECALGATCPSGTNCVNTQGSFYCDCGHG 356 Query: 327 YH 332 YH Sbjct: 357 YH 358 >SB_21309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1286 Score = 33.1 bits (72), Expect = 0.12 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = +3 Query: 159 ECSEPCINGVCTEGNQCVCNPGYSMDLTDR--RCK-PRCAGGC 278 EC C+NG QC C GY+M+ + +C+ P+ G C Sbjct: 471 ECVPECLNGGVCVNRQCQCPQGYTMEACQKVNKCELPKPTGPC 513 >SB_4760| Best HMM Match : EGF (HMM E-Value=8.29989e-42) Length = 240 Score = 33.1 bits (72), Expect = 0.12 Identities = 23/86 (26%), Positives = 34/86 (39%), Gaps = 9/86 (10%) Frame = +3 Query: 171 PCING-VCTE-----GNQCVCNPGYS---MDLTDRRCKPRCAGGCPNGLCSGPNLCICNM 323 PC+NG C E G +C C GY D+ D C G +G C C Sbjct: 83 PCMNGGKCVETLSGTGYECSCPSGYRGEVCDVIDNCLSNPCQNGATCNSVAGGFTCTCTP 142 Query: 324 GYHKDTSVKGRAVCVKRIRRSLNYFL 401 Y ++ + R V + + + N +L Sbjct: 143 EYRGNSVTRKRHVTLTHVTMAGNVYL 168 >SB_786| Best HMM Match : EGF (HMM E-Value=0) Length = 1427 Score = 33.1 bits (72), Expect = 0.12 Identities = 25/78 (32%), Positives = 37/78 (47%), Gaps = 5/78 (6%) Frame = +3 Query: 114 VQGGHVNGQNTQRFPECSEPCINGVCTEGN----QCVCNPGYSMDLTDRRCKPRCAGGCP 281 +Q G + Q ++ E PC +G C E N QC C+ GY T + C+ C+ P Sbjct: 152 IQEGTESYQCVKKMCE-PNPCQHGRCIEVNDDDYQCACDAGY----TGKNCENFCS---P 203 Query: 282 NGLCSGPNLCIC-NMGYH 332 N C +C+ +GYH Sbjct: 204 NP-CKNNGVCVSRGVGYH 220 Score = 29.5 bits (63), Expect = 1.5 Identities = 20/60 (33%), Positives = 26/60 (43%), Gaps = 7/60 (11%) Frame = +3 Query: 171 PCING-----VCTEGNQCVCNPGYSMDLTDRR-CKPR-CAGGCPNGLCSGPNLCICNMGY 329 PC+NG V +G QC C GY+ +R C P C G + +LC C Y Sbjct: 278 PCLNGGICKSVADKGYQCKCREGYNGPHCERSPCAPNPCLNGGTCVVFYTVHLCKCPAHY 337 >SB_33986| Best HMM Match : EGF_CA (HMM E-Value=3.5e-17) Length = 85 Score = 33.1 bits (72), Expect = 0.12 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 1/69 (1%) Frame = +3 Query: 150 RFP-ECSEPCINGVCTEGNQCVCNPGYSMDLTDRRCKPRCAGGCPNGLCSGPNLCICNMG 326 +FP CS C NG T +C+C PG+ + +R C+ P+ C C+ G Sbjct: 6 QFPGACSHICQNGYGTF--RCICRPGFYLLDDERTCEDLDECSLPSTKCPDGQRCVNTPG 63 Query: 327 YHKDTSVKG 353 ++ S G Sbjct: 64 NYRCESPCG 72 >SB_32754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5659 Score = 33.1 bits (72), Expect = 0.12 Identities = 21/53 (39%), Positives = 25/53 (47%), Gaps = 9/53 (16%) Frame = +3 Query: 207 CVCNPGYSMDLTDRRCKPR--CAGG---C-PNGLCS---GPNLCICNMGYHKD 338 CVC GY + D CK + C G C PN LC+ G LC C G+ D Sbjct: 607 CVCKNGY--QIVDGECKDKNECVGSDLLCDPNALCTNTPGSYLCRCKSGFQGD 657 Score = 31.5 bits (68), Expect = 0.37 Identities = 23/71 (32%), Positives = 30/71 (42%), Gaps = 11/71 (15%) Frame = +3 Query: 159 ECSEPC-INGVC---TEGNQCVCNPGYSMDLTD-RRC--KPRCAGGC-PNGLCSGP---N 305 EC+ C N C G +CVC G+S D C + C C N +C+GP Sbjct: 341 ECNPACGNNSECKMQAAGAECVCKMGFSSATEDGLSCVAESACVPACGDNAVCAGPIDDK 400 Query: 306 LCICNMGYHKD 338 C C G+ D Sbjct: 401 RCECKDGFQGD 411 >SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 33.1 bits (72), Expect = 0.12 Identities = 26/83 (31%), Positives = 33/83 (39%), Gaps = 5/83 (6%) Frame = +3 Query: 132 NGQNTQRFPECSEPCING-VCTEGN---QCVCNPGYSMDLTDRRCK-PRCAGGCPNGLCS 296 NG Q PC NG C E +C+C GY + C+ RC N C Sbjct: 203 NGVTCQNHVCRPNPCQNGGSCLEEGGLGRCICQMGYH----GQHCENDRCRFCSVNADCI 258 Query: 297 GPNLCICNMGYHKDTSVKGRAVC 365 + C+C GYH D + VC Sbjct: 259 LGH-CVCKDGYHGDGKTCNKNVC 280 >SB_6849| Best HMM Match : EGF_2 (HMM E-Value=9.3e-11) Length = 439 Score = 32.7 bits (71), Expect = 0.16 Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 4/60 (6%) Frame = +3 Query: 162 CSEPCINGVCTEG-NQCVCNPGYSMDLTDRRCKPRCAGGCPN--GLCS-GPNLCICNMGY 329 CS PC +G CT ++C C +S D C + G CS GP+ C C GY Sbjct: 10 CSVPCSHGRCTTAPDKCECEKYWSG--ADCGTYIGTCNNCSSVGGTCSAGPDTCACRPGY 67 Score = 32.7 bits (71), Expect = 0.16 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = +3 Query: 159 ECSEPCINGVC-TEGNQCVCNPGYSMDLTDRRCKPRCAGGCPNGLCSGPNLCICNMGY 329 +C+EPC+ G C ++ +C C Y+ D P C CP P C C+ G+ Sbjct: 121 KCTEPCVYGTCPSDPFKCECRAPYTGTQCDTIKCPEC---CP------PETCDCSSGH 169 >SB_16910| Best HMM Match : EGF (HMM E-Value=0) Length = 1552 Score = 32.3 bits (70), Expect = 0.21 Identities = 17/63 (26%), Positives = 27/63 (42%), Gaps = 9/63 (14%) Frame = +3 Query: 168 EPCINGVCT-----EGNQCVCNPGYSMDLTDRRCKPRCAGGCPNGLCSGPNL----CICN 320 +PC++G G+QC C PGY+ + + C NG + C+C+ Sbjct: 634 DPCLHGAACIFLSDGGSQCQCLPGYTGAFCETNINECLSSPCKNGATCVDRVDGFKCVCD 693 Query: 321 MGY 329 GY Sbjct: 694 AGY 696 Score = 29.1 bits (62), Expect = 2.0 Identities = 21/56 (37%), Positives = 26/56 (46%), Gaps = 5/56 (8%) Frame = +3 Query: 135 GQNTQRFPEC-SEPCIN-GVC--TE-GNQCVCNPGYSMDLTDRRCKPRCAGGCPNG 287 G+ Q +C S+PC N G C TE G QC C G+ D+ A C NG Sbjct: 430 GKTCQLSKDCHSQPCQNAGTCINTETGFQCRCAHGWEGPTCDQNTNECAARPCING 485 Score = 27.1 bits (57), Expect = 7.9 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 5/32 (15%) Frame = +3 Query: 159 EC-SEPCINGV-CTE---GNQCVCNPGYSMDL 239 EC S PC NG C + G +CVC+ GY L Sbjct: 669 ECLSSPCKNGATCVDRVDGFKCVCDAGYQGSL 700 >SB_47055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 933 Score = 31.9 bits (69), Expect = 0.28 Identities = 22/66 (33%), Positives = 28/66 (42%), Gaps = 10/66 (15%) Frame = +3 Query: 162 CSEPCINGVCTEGNQCVCNPGYSMDLTDRRC--KPRCA---GGCP--NGLC---SGPNLC 311 C + C N +C +C C PG+ M R C C GGC +G C G + C Sbjct: 459 CEQVCYN-LCNLKVKCGCYPGFKMAYDGRTCIDIDECQVNNGGCDIFHGQCINTPGSHHC 517 Query: 312 ICNMGY 329 C GY Sbjct: 518 ACRNGY 523 Score = 28.3 bits (60), Expect = 3.4 Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 10/54 (18%) Frame = +3 Query: 198 GNQCVCNPGYSMDLTDRRCK---PRCAGGCPNGLCSGPNL-----CI--CNMGY 329 G C CNPGY + D+ C+ GG CS ++ C+ CN GY Sbjct: 597 GYYCTCNPGYRLMDDDKSCEVLSDLAQGGVMPRSCSMKDVEYGTRCVYYCNQGY 650 >SB_5020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 687 Score = 31.9 bits (69), Expect = 0.28 Identities = 29/83 (34%), Positives = 36/83 (43%), Gaps = 14/83 (16%) Frame = +3 Query: 132 NGQNTQRFPECS---EPCI-NGVC--TEGN-QCVCNPGYSMDLTDRRCKPRCAGG---C- 278 +GQ ECS C N C T G+ C CNPG+S D + C G C Sbjct: 104 DGQMCSETDECSAGNHTCDKNAKCNNTIGSYHCTCNPGFSGDGRNCTDIDECVTGNHTCD 163 Query: 279 PNGLCS---GPNLCICNMGYHKD 338 N C+ G C+CN G+ KD Sbjct: 164 KNAKCNNIIGSYHCMCNPGFSKD 186 Score = 31.9 bits (69), Expect = 0.28 Identities = 20/66 (30%), Positives = 29/66 (43%), Gaps = 7/66 (10%) Frame = +3 Query: 162 CSEPCINGVCTEGNQCVCNPGYSMDLTDRRCKPRCAGG---C-PNGLCS---GPNLCICN 320 C + G + C+CNPG+S D + C G C N C+ G + C+CN Sbjct: 244 CDKNARCGNIIGSHHCICNPGFSGDGKNCTDIDECVTGDHTCDKNAKCNNTIGSHHCMCN 303 Query: 321 MGYHKD 338 G+ D Sbjct: 304 PGFSGD 309 Score = 30.3 bits (65), Expect = 0.85 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 7/51 (13%) Frame = +3 Query: 207 CVCNPGYSMDLTDRRCKPRCAGG---C-PNGLCS---GPNLCICNMGYHKD 338 C+CNPG+S D + C G C N C+ G C+CN G+ D Sbjct: 177 CMCNPGFSKDGRECTDIDECVTGDHTCDKNARCNNIIGSYHCMCNPGFSGD 227 Score = 30.3 bits (65), Expect = 0.85 Identities = 18/51 (35%), Positives = 23/51 (45%), Gaps = 7/51 (13%) Frame = +3 Query: 207 CVCNPGYSMDLTDRRCKPRCAGG---C-PNGLCS---GPNLCICNMGYHKD 338 C CNPG+S D + C G C N C+ G + C CN G+ D Sbjct: 464 CTCNPGFSGDGRECTDMDECVTGDHTCDKNAKCNNIIGSHHCTCNPGFSGD 514 Score = 28.3 bits (60), Expect = 3.4 Identities = 18/51 (35%), Positives = 22/51 (43%), Gaps = 7/51 (13%) Frame = +3 Query: 207 CVCNPGYSMDLTDRRCKPRCAGG---C-PNGLCS---GPNLCICNMGYHKD 338 C CNPG+S D + C G C N C+ G C CN G+ D Sbjct: 341 CTCNPGFSGDGRECTDIDECVTGDHTCDKNARCNNTIGSYHCTCNPGFSGD 391 Score = 27.9 bits (59), Expect = 4.5 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 7/50 (14%) Frame = +3 Query: 201 NQCVCNPGYSMDLTDRRCKPRCAGG---C-PNGLCS---GPNLCICNMGY 329 + C CNPG+S D + C G C N C+ G + C CN G+ Sbjct: 503 HHCTCNPGFSGDGRECIDIDECVTGDHTCDKNAKCNNIVGSHHCTCNPGF 552 Score = 27.1 bits (57), Expect = 7.9 Identities = 18/51 (35%), Positives = 22/51 (43%), Gaps = 7/51 (13%) Frame = +3 Query: 207 CVCNPGYSMDLTDRRCKPRCAGG---C-PNGLCS---GPNLCICNMGYHKD 338 C CNPG+S D + C G C N C+ G C CN G+ D Sbjct: 423 CRCNPGFSGDGRECTDIDECVTGDHTCDKNARCNNTIGSYHCTCNPGFSGD 473 >SB_20264| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 480 Score = 31.5 bits (68), Expect = 0.37 Identities = 23/67 (34%), Positives = 32/67 (47%), Gaps = 9/67 (13%) Frame = +3 Query: 159 EC-SEPCINGV-CTEGNQ---CVCNPGYSMDLTDRRCKPRCAGGCPN-GLCS-GPN--LC 311 EC S PC NG C +G C C PG++ + +G C N G C+ G N C Sbjct: 218 ECASGPCQNGATCNDGVNNYTCSCIPGFNGTNCETNIDECASGPCQNGGTCNDGVNNYTC 277 Query: 312 ICNMGYH 332 +C G++ Sbjct: 278 LCIPGFN 284 >SB_53569| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 921 Score = 31.1 bits (67), Expect = 0.49 Identities = 28/87 (32%), Positives = 37/87 (42%), Gaps = 17/87 (19%) Frame = +3 Query: 120 GGHVNGQNTQRFP--ECSEP------CINGVCTEGNQCVCNPGYSMDLTDRRCK--PRC- 266 G H++ N Q ECS P CIN + C C+ G+ + L +R C C Sbjct: 301 GYHLHSDNKQCIDDDECSNPNRCDHVCINNPGSYA--CACHKGFFLKLDERSCADLDECF 358 Query: 267 ---AGGCPNGLC---SGPNLCICNMGY 329 GGC + LC G C C+ GY Sbjct: 359 LLNNGGC-SQLCLNTQGSYRCACDYGY 384 Score = 27.1 bits (57), Expect = 7.9 Identities = 12/40 (30%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +3 Query: 162 CSEPCINGVCTEGNQCVCNPGYSMDLTDRRC-KPRCAGGC 278 C + C N + + +C C PGY + + C K + GC Sbjct: 614 CQQTCNNSIGSF--KCTCRPGYHLAIDGFSCTKEKAPPGC 651 >SB_47667| Best HMM Match : Ldl_recept_a (HMM E-Value=0) Length = 3891 Score = 31.1 bits (67), Expect = 0.49 Identities = 23/95 (24%), Positives = 41/95 (43%), Gaps = 8/95 (8%) Frame = +3 Query: 162 CSEPCINGVCTEGNQCVCNPGYSMDLTDRRCK--------PRCAGGCPNGLCSGPNLCIC 317 C++ C++ EG QC C PG+++ ++ C+ C+ C N G C C Sbjct: 1175 CAQLCMD--VPEGVQCSCRPGFTLASDNKTCEDINECLNSSSCSQRCFN--TRGSFSCKC 1230 Query: 318 NMGYHKDTSVKGRAVCVKRIRRSLNYFLSKKLKSI 422 GY + K R IR L + ++++ + Sbjct: 1231 VQGYRLEPD-KRRCKAADSIRPFLYFSTRREIRKL 1264 Score = 27.5 bits (58), Expect = 6.0 Identities = 20/64 (31%), Positives = 27/64 (42%), Gaps = 10/64 (15%) Frame = +3 Query: 204 QCVCNPGYSMDLTDRR-------CKPRCAGGCPNGLC---SGPNLCICNMGYHKDTSVKG 353 +C C PGY + ++D R CK GC N C G C C GY + + Sbjct: 2543 RCSCRPGYLL-MSDGRSCQDVDECKSYALNGC-NQFCINLKGSFKCTCAKGYRLEP--RN 2598 Query: 354 RAVC 365 R +C Sbjct: 2599 RRIC 2602 >SB_11375| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 651 Score = 31.1 bits (67), Expect = 0.49 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 6/62 (9%) Frame = +3 Query: 162 CSEPCINGVCTEGNQCVCNPGYSMDLTDRRC--KPRC-AGGCPNGLC---SGPNLCICNM 323 C + C N +C C GY +DL + C K C G + LC +G C C+ Sbjct: 237 CQQTCTN--LPGSYRCSCYKGYELDLDGKTCSDKDECKTGSNCSQLCTNTAGGYQCSCHH 294 Query: 324 GY 329 GY Sbjct: 295 GY 296 Score = 27.9 bits (59), Expect = 4.5 Identities = 20/71 (28%), Positives = 25/71 (35%), Gaps = 8/71 (11%) Frame = +3 Query: 162 CSEPCINGVCTEGNQCVCNPGYSMDLTDRRCKP--------RCAGGCPNGLCSGPNLCIC 317 C + C+N G C CN G+ + +R C C C N G C C Sbjct: 197 CGQRCLN--FPGGYNCTCNSGFILIPDNRTCNDTDECLDSNTCQQTCTN--LPGSYRCSC 252 Query: 318 NMGYHKDTSVK 350 GY D K Sbjct: 253 YKGYELDLDGK 263 >SB_28221| Best HMM Match : eRF1_3 (HMM E-Value=8.7) Length = 348 Score = 31.1 bits (67), Expect = 0.49 Identities = 22/84 (26%), Positives = 35/84 (41%), Gaps = 5/84 (5%) Frame = +3 Query: 18 TYQPRPDPFYQP----HKPNQPDHHITPNRTNDLSSVQ-GGHVNGQNTQRFPECSEPCIN 182 TY+ DP YQP H+ ++ TP R VQ NG + + + + + Sbjct: 175 TYKKSKDPLYQPLCNLHQVHEGTVQFTPTRKEGGEMVQRNSGQNGYSPKSTAQSNLSYLP 234 Query: 183 GVCTEGNQCVCNPGYSMDLTDRRC 254 G + C+C G + D + RC Sbjct: 235 GRVSRPYYCIC--GINKDTSKERC 256 >SB_40116| Best HMM Match : EGF (HMM E-Value=0) Length = 340 Score = 30.7 bits (66), Expect = 0.65 Identities = 21/63 (33%), Positives = 26/63 (41%), Gaps = 8/63 (12%) Frame = +3 Query: 165 SEPCINGV-CTE---GNQCVCNPGYSMDLTDRRCKPRCAGGCPNGL-C---SGPNLCICN 320 SEPC+N C + G C+C PGY+ D C NG C C+C Sbjct: 45 SEPCMNNATCVDEQDGFTCICAPGYTGPTCDGDIDECAFNPCLNGAECINLENGFECVCL 104 Query: 321 MGY 329 GY Sbjct: 105 PGY 107 Score = 29.5 bits (63), Expect = 1.5 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 5/37 (13%) Frame = +3 Query: 159 ECS-EPCINGV-CTE---GNQCVCNPGYSMDLTDRRC 254 EC+ PC+NG C G +CVC PGY T +RC Sbjct: 80 ECAFNPCLNGAECINLENGFECVCLPGY----TGKRC 112 >SB_31961| Best HMM Match : EGF (HMM E-Value=0) Length = 2813 Score = 30.7 bits (66), Expect = 0.65 Identities = 23/66 (34%), Positives = 28/66 (42%), Gaps = 9/66 (13%) Frame = +3 Query: 159 EC-SEPCING-VCTE---GNQCVCNPGYSMDLTDRRCKPRCAGGCPN-GLCS---GPNLC 311 EC S PC NG +CT+ C C PGY+ D + C N G C+ C Sbjct: 1633 ECASSPCQNGGLCTDMINAFTCTCPPGYTGITCDIDIDECASSPCQNGGFCTDMINAFTC 1692 Query: 312 ICNMGY 329 C GY Sbjct: 1693 SCPPGY 1698 Score = 30.7 bits (66), Expect = 0.65 Identities = 24/66 (36%), Positives = 30/66 (45%), Gaps = 9/66 (13%) Frame = +3 Query: 159 EC-SEPCING-VCTE---GNQCVCNPGYSMDLTDRRCKPRCAGGCPN-GLC-SGPN--LC 311 EC S PC NG CT+ C C PGY+ D + C N G+C G N C Sbjct: 1709 ECASSPCQNGGFCTDMINAFTCTCLPGYTGITCDINIDDCASRPCQNGGICKDGINEFKC 1768 Query: 312 ICNMGY 329 C+ G+ Sbjct: 1769 QCSAGF 1774 Score = 29.9 bits (64), Expect = 1.1 Identities = 23/66 (34%), Positives = 27/66 (40%), Gaps = 9/66 (13%) Frame = +3 Query: 159 EC-SEPCING-VCTE---GNQCVCNPGYSMDLTDRRCKPRCAGGCPN-GLCS---GPNLC 311 EC S PC NG CT+ C C PGY+ D + C N G C+ C Sbjct: 1671 ECASSPCQNGGFCTDMINAFTCSCPPGYTGITCDINIDECASSPCQNGGFCTDMINAFTC 1730 Query: 312 ICNMGY 329 C GY Sbjct: 1731 TCLPGY 1736 Score = 29.1 bits (62), Expect = 2.0 Identities = 22/67 (32%), Positives = 29/67 (43%), Gaps = 9/67 (13%) Frame = +3 Query: 159 EC-SEPCIN-GVCTE---GNQCVCNPGYSMDLTDRRCKPRCAGGCPN-GLC---SGPNLC 311 EC S PC + C + C C+PGYS + + C N G C G LC Sbjct: 1785 ECASAPCQHRSTCKDLINDYNCTCHPGYSGRNCEHEIDECISSPCRNKGYCYDAIGYYLC 1844 Query: 312 ICNMGYH 332 IC G++ Sbjct: 1845 ICPPGFY 1851 >SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5222 Score = 30.7 bits (66), Expect = 0.65 Identities = 25/97 (25%), Positives = 35/97 (36%), Gaps = 4/97 (4%) Frame = +3 Query: 51 PHKPNQPDHHITPNRTNDLSSVQGGHVNGQNTQRFPECSEPCINGVCTE---GNQCV-CN 218 PHK P H P + D + GH + P + C G + G C+ C Sbjct: 3118 PHKNPCPLGHFCPEGSGDKNPCSPGHYGDRELATSPSDCKKCSAGDFNDQPGGKACLRCG 3177 Query: 219 PGYSMDLTDRRCKPRCAGGCPNGLCSGPNLCICNMGY 329 + D+ C C G + S + CIC GY Sbjct: 3178 SSSTSDVGAATC--TCIGKFRSFQLSDRS-CICQSGY 3211 >SB_25956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1146 Score = 30.7 bits (66), Expect = 0.65 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +3 Query: 252 CKPRCAGGCPNGLCSGPNLCICNMGYHKDT 341 C P+C G G+C GPN C C + DT Sbjct: 736 CSPKCQNG---GVCIGPNTCKCPTLFVGDT 762 >SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3287 Score = 30.7 bits (66), Expect = 0.65 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 7/47 (14%) Frame = +3 Query: 123 GHVNGQNTQRFPEC-SEPCIN-GVCTE-----GNQCVCNPGYSMDLT 242 G + Q EC S+PC+N G C E G QCVC G++ D + Sbjct: 846 GFLGRQCEANVVECLSDPCLNNGTCVEKIGVVGYQCVCPDGFAGDFS 892 >SB_49700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 7645 Score = 30.7 bits (66), Expect = 0.65 Identities = 21/63 (33%), Positives = 26/63 (41%), Gaps = 8/63 (12%) Frame = +3 Query: 165 SEPCINGV-CTE---GNQCVCNPGYSMDLTDRRCKPRCAGGCPNGL-C---SGPNLCICN 320 SEPC+N C + G C+C PGY+ D C NG C C+C Sbjct: 7091 SEPCMNNATCVDEQDGFTCICAPGYTGPTCDGDIDECAFNPCLNGAECINLENGFECVCL 7150 Query: 321 MGY 329 GY Sbjct: 7151 PGY 7153 Score = 29.5 bits (63), Expect = 1.5 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 5/37 (13%) Frame = +3 Query: 159 ECS-EPCINGV-CTE---GNQCVCNPGYSMDLTDRRC 254 EC+ PC+NG C G +CVC PGY T +RC Sbjct: 7126 ECAFNPCLNGAECINLENGFECVCLPGY----TGKRC 7158 >SB_16119| Best HMM Match : EGF (HMM E-Value=2e-20) Length = 76 Score = 30.7 bits (66), Expect = 0.65 Identities = 22/66 (33%), Positives = 31/66 (46%), Gaps = 9/66 (13%) Frame = +3 Query: 159 ECS-EPCING-VCTEGN---QCVCNPGYSMDLTDRRCKPRCAGGCPNG-LCS-GPN--LC 311 EC+ PC NG +C +G +C C GY+ + +G C NG C+ G N C Sbjct: 3 ECAGNPCANGGICKDGINSFKCTCPAGYTGSKCETDIDDCASGPCQNGATCNDGVNKYTC 62 Query: 312 ICNMGY 329 C G+ Sbjct: 63 SCIPGF 68 >SB_11521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 953 Score = 30.7 bits (66), Expect = 0.65 Identities = 18/62 (29%), Positives = 24/62 (38%), Gaps = 3/62 (4%) Frame = +3 Query: 54 HKPNQPDHHITPNRTNDLSSVQGGHVNGQNTQRFPECSEPCINGVCTE---GNQCVCNPG 224 H P HH+ N T+ + HV G T P + + G T GN PG Sbjct: 550 HVPGNTTHHVPGNTTHHVPGYTTHHVPGNTTHHVPGYATHHVPGYTTHHVPGNTTHHVPG 609 Query: 225 YS 230 Y+ Sbjct: 610 YT 611 Score = 29.5 bits (63), Expect = 1.5 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +3 Query: 54 HKPNQPDHHITPNRTNDLSSVQGGHVNGQNTQRFP 158 H P HH+ N T+ +S HV G T P Sbjct: 391 HVPGNTTHHVPGNTTHHVSGYTTHHVPGNTTHHVP 425 Score = 29.5 bits (63), Expect = 1.5 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +3 Query: 54 HKPNQPDHHITPNRTNDLSSVQGGHVNGQNTQRFP 158 H P HH+ N T+ +S HV G T P Sbjct: 798 HVPGNTTHHVPGNTTHHVSGYTTHHVPGNTTHHVP 832 Score = 29.5 bits (63), Expect = 1.5 Identities = 18/63 (28%), Positives = 26/63 (41%), Gaps = 3/63 (4%) Frame = +3 Query: 54 HKPNQPDHHITPNRTNDLSSVQGGHVNGQNTQRFPECSEPCINGVCTE---GNQCVCNPG 224 H P HH+ N T+ + HV G T P + + G T+ GN PG Sbjct: 878 HVPGYTTHHVPGNTTHHVPGNTTHHVPGYTTHHVPGNTTDHVPGNTTDHVPGNTTHHVPG 937 Query: 225 YSM 233 Y++ Sbjct: 938 YTV 940 Score = 29.1 bits (62), Expect = 2.0 Identities = 18/62 (29%), Positives = 23/62 (37%), Gaps = 3/62 (4%) Frame = +3 Query: 54 HKPNQPDHHITPNRTNDLSSVQGGHVNGQNTQRFPECSEPCINGVCTE---GNQCVCNPG 224 H P HH+ N T + HV G T P + + G T GN PG Sbjct: 846 HVPGNTTHHVPGNTTYHVQGNTAHHVPGNKTHHVPGYTTHHVPGNTTHHVPGNTTHHVPG 905 Query: 225 YS 230 Y+ Sbjct: 906 YT 907 Score = 28.7 bits (61), Expect = 2.6 Identities = 16/60 (26%), Positives = 22/60 (36%) Frame = +3 Query: 54 HKPNQPDHHITPNRTNDLSSVQGGHVNGQNTQRFPECSEPCINGVCTEGNQCVCNPGYSM 233 H P HH+ N T HV G TQ P + + G T Q + + Y + Sbjct: 455 HVPGNTPHHVPGNTTPQEPGNTPNHVPGITTQHIPGYTTHHVPGYATRHVQVIRHTMYQV 514 Score = 28.3 bits (60), Expect = 3.4 Identities = 13/48 (27%), Positives = 21/48 (43%) Frame = +3 Query: 54 HKPNQPDHHITPNRTNDLSSVQGGHVNGQNTQRFPECSEPCINGVCTE 197 H P HH+ N T+ + HV G T + P + + G+ T+ Sbjct: 439 HVPGNTTHHVPGNTTHHVPGNTPHHVPGNTTPQEPGNTPNHVPGITTQ 486 Score = 27.9 bits (59), Expect = 4.5 Identities = 11/35 (31%), Positives = 15/35 (42%) Frame = +3 Query: 54 HKPNQPDHHITPNRTNDLSSVQGGHVNGQNTQRFP 158 H P HH+ N+T+ + HV G T P Sbjct: 335 HVPGYTAHHVPGNKTHHVPGYTTHHVPGNTTHHVP 369 Score = 27.9 bits (59), Expect = 4.5 Identities = 13/47 (27%), Positives = 19/47 (40%) Frame = +3 Query: 54 HKPNQPDHHITPNRTNDLSSVQGGHVNGQNTQRFPECSEPCINGVCT 194 H P HH+ N T+ + HV G T P + ++G T Sbjct: 367 HVPGNTTHHVPGNTTHHVPGNTTHHVPGNTTHHVPGNTTHHVSGYTT 413 Score = 27.5 bits (58), Expect = 6.0 Identities = 11/35 (31%), Positives = 15/35 (42%) Frame = +3 Query: 54 HKPNQPDHHITPNRTNDLSSVQGGHVNGQNTQRFP 158 H P HH+ N T+ + HV+G T P Sbjct: 383 HVPGNTTHHVPGNTTHHVPGNTTHHVSGYTTHHVP 417 Score = 27.5 bits (58), Expect = 6.0 Identities = 13/47 (27%), Positives = 19/47 (40%) Frame = +3 Query: 54 HKPNQPDHHITPNRTNDLSSVQGGHVNGQNTQRFPECSEPCINGVCT 194 H P HH+ N T+ + HV G T + P + + G T Sbjct: 694 HVPGYTVHHVPGNTTHHVPGYTAHHVPGYTTHQVPGYTTHHVPGYTT 740 Score = 27.5 bits (58), Expect = 6.0 Identities = 11/35 (31%), Positives = 15/35 (42%) Frame = +3 Query: 54 HKPNQPDHHITPNRTNDLSSVQGGHVNGQNTQRFP 158 H P HH+ N T+ + HV+G T P Sbjct: 790 HVPGNTTHHVPGNTTHHVPGNTTHHVSGYTTHHVP 824 >SB_7343| Best HMM Match : EGF (HMM E-Value=0) Length = 1233 Score = 30.7 bits (66), Expect = 0.65 Identities = 19/59 (32%), Positives = 24/59 (40%), Gaps = 3/59 (5%) Frame = +3 Query: 159 ECSEPCINGVCTEGNQCVCNPGYSMDLTDRRCKPRCAGGCPNGLCSGPNLCI---CNMG 326 EC PC+N C G C + D D CK C G C+ + C+ CN G Sbjct: 683 ECDAPCVNNPCHNGGTCTPD---GDDPHDYDCK--CPSGYQGKSCTLISACVGDPCNGG 736 >SB_59784| Best HMM Match : EGF (HMM E-Value=0.0012) Length = 43 Score = 30.3 bits (65), Expect = 0.85 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 162 CSEPCINGVCTEGNQCVCNPGYSMDLTDRRCK 257 C + CIN V G++C+C+ GY + R C+ Sbjct: 12 CQQYCINLV-DGGHRCMCHEGYKLSSNGRDCE 42 >SB_43565| Best HMM Match : EGF (HMM E-Value=2.8e-05) Length = 192 Score = 30.3 bits (65), Expect = 0.85 Identities = 11/24 (45%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = +3 Query: 162 CSEPCINGV-CTEGNQCVCNPGYS 230 C PC+NG C N C C PG++ Sbjct: 152 CDPPCLNGGRCKAPNTCACLPGWT 175 Score = 27.1 bits (57), Expect = 7.9 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +3 Query: 252 CKPRCAGGCPNGLCSGPNLCICNMGY 329 C P C G G C PN C C G+ Sbjct: 152 CDPPCLNG---GRCKAPNTCACLPGW 174 >SB_41418| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 3312 Score = 30.3 bits (65), Expect = 0.85 Identities = 21/63 (33%), Positives = 28/63 (44%), Gaps = 7/63 (11%) Frame = +3 Query: 162 CSEPCINGVCTEGNQCVCNPGYSMDLTDRRCK--PRCA--GGCPNGLC---SGPNLCICN 320 C CIN + T +C C GY ++ R C+ CA GC LC G C C+ Sbjct: 446 CEHECINIIGTY--RCRCRDGYKLEPNRRTCQDLDECALFSGC-EMLCHNTRGSYYCACS 502 Query: 321 MGY 329 G+ Sbjct: 503 EGF 505 >SB_41134| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 802 Score = 30.3 bits (65), Expect = 0.85 Identities = 14/51 (27%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = +3 Query: 162 CSEPCINGVCTEGNQCVCNPGYSMDLTDRRCKP--RCAGGCPNGLCSGPNL 308 C + C+N G C C+ GY+++ + C+ A P +C PN+ Sbjct: 132 CGQVCLN--TPNGRICSCHHGYTLEFDEESCRAFLILAALIPPTVCRSPNV 180 Score = 29.5 bits (63), Expect = 1.5 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 162 CSEPCINGVCTEGNQ-CVCNPGYSMDLTDRRCKPRCAGGCP 281 C + C+N TEG+ C C PGY + R C+ A P Sbjct: 755 CEKECVN---TEGSYFCFCPPGYQLTDDKRHCQGDQARNIP 792 >SB_29802| Best HMM Match : Laminin_EGF (HMM E-Value=0) Length = 546 Score = 30.3 bits (65), Expect = 0.85 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Frame = +3 Query: 153 FPECSE-PCIN---GVCTEGNQCVCNPGYSMDLTDRRCKPRCAGG 275 FP C + C N G C + +C+C PGY T R C+ CA G Sbjct: 87 FPLCIKCACSNSGFGTCGQYGECICRPGY----TGRSCE-SCAKG 126 >SB_58882| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 1027 Score = 30.3 bits (65), Expect = 0.85 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +3 Query: 162 CSEPCINGVCTEGN-QCVCNPGYSMDLTDRRCK 257 C C+N EG+ C+CN G+ +D ++CK Sbjct: 788 CQHGCVNN--PEGSYHCICNYGFVLDADRKKCK 818 >SB_3108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 631 Score = 30.3 bits (65), Expect = 0.85 Identities = 23/63 (36%), Positives = 30/63 (47%), Gaps = 10/63 (15%) Frame = +3 Query: 180 NGVC--TEGN-QCVCNPGYSMDLTDRRCKPRCAGG---C-PNGLCS---GPNLCICNMGY 329 N +C T G+ C CNPG+S D + CA G C N C+ G C+CN G+ Sbjct: 210 NAICNNTIGSYHCRCNPGFSGDGRNCTDIDECATGDHICDKNAKCNNTIGSYHCMCNPGF 269 Query: 330 HKD 338 D Sbjct: 270 SGD 272 Score = 29.9 bits (64), Expect = 1.1 Identities = 28/83 (33%), Positives = 36/83 (43%), Gaps = 14/83 (16%) Frame = +3 Query: 132 NGQNTQRFPECS---EPC-INGVC--TEGN-QCVCNPGYSMDLTDRRCKPRCAGG---C- 278 +GQ ECS C N C T G+ C+CNPG+S D + C G C Sbjct: 149 DGQMCSETDECSAGNHTCGKNAKCNNTIGSYHCMCNPGFSGDGRECTDIDECVTGDHTCD 208 Query: 279 PNGLCS---GPNLCICNMGYHKD 338 N +C+ G C CN G+ D Sbjct: 209 KNAICNNTIGSYHCRCNPGFSGD 231 Score = 29.1 bits (62), Expect = 2.0 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 7/51 (13%) Frame = +3 Query: 207 CVCNPGYSMDLTDRRCKPRCAGG---C-PNGLCS---GPNLCICNMGYHKD 338 C+CNPG+S D + C G C N C+ G C+CN G+ D Sbjct: 263 CMCNPGFSGDGRNCTDIDECVTGDHTCDKNAKCNNTIGSYHCMCNPGFSGD 313 Score = 28.7 bits (61), Expect = 2.6 Identities = 18/51 (35%), Positives = 23/51 (45%), Gaps = 7/51 (13%) Frame = +3 Query: 207 CVCNPGYSMDLTDRRCKPRCAGG---C-PNGLCS---GPNLCICNMGYHKD 338 C+CNPG+S D + C G C N C+ G C CN G+ D Sbjct: 427 CMCNPGFSGDGRECTDIDECVTGDHTCDKNAKCNNIIGSYHCTCNPGFSGD 477 Score = 27.9 bits (59), Expect = 4.5 Identities = 18/51 (35%), Positives = 22/51 (43%), Gaps = 7/51 (13%) Frame = +3 Query: 207 CVCNPGYSMDLTDRRCKPRCAGG---C-PNGLCS---GPNLCICNMGYHKD 338 C CNPG+S D + C G C N C+ G C CN G+ D Sbjct: 345 CTCNPGFSGDGRNCTDIDECVTGDHTCDKNAKCNNTIGSYHCTCNPGFSGD 395 >SB_11257| Best HMM Match : GCC2_GCC3 (HMM E-Value=2.7e-11) Length = 3810 Score = 29.9 bits (64), Expect = 1.1 Identities = 25/97 (25%), Positives = 37/97 (38%), Gaps = 7/97 (7%) Frame = +3 Query: 6 NGTITYQPRPDPFYQPHKPNQP-----DHHITP--NRTNDLSSVQGGHVNGQNTQRFPEC 164 N +++ P P +Y P +QP H+ P N ND + G + + Sbjct: 3453 NRSMSQAPCPAGYYCPRNSSQPVLCPPGHYCDPKLNCYNDSNHEAGACTPRICPLGYAQK 3512 Query: 165 SEPCINGVCTEGNQCVCNPGYSMDLTDRRCKPRCAGG 275 + EG +C PGY + DR RC GG Sbjct: 3513 TSGADLFKTFEGTCEICRPGYYGNAADRNTCKRCRGG 3549 >SB_5182| Best HMM Match : TSP_1 (HMM E-Value=1.1e-11) Length = 1417 Score = 29.9 bits (64), Expect = 1.1 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +3 Query: 180 NGVCTEGNQCVCNPGYSM 233 +GVCT +C C+PGY + Sbjct: 536 HGVCTNEGKCACDPGYDI 553 Score = 29.5 bits (63), Expect = 1.5 Identities = 23/93 (24%), Positives = 38/93 (40%), Gaps = 8/93 (8%) Frame = +3 Query: 75 HHITPNRTNDLSSVQGGHVNGQNTQR---FPECSEPCINGVCTEGNQCVCNPGYSM-DLT 242 HH+ RT D++ V H+N R + + V + C+ + S+ L Sbjct: 462 HHVRKGRTEDMACVTHRHLNHVRKGRAGNIARVTHQHLRHVLKGEDICINHKCESLSSLR 521 Query: 243 DRRCK----PRCAGGCPNGLCSGPNLCICNMGY 329 + C CAG +G+C+ C C+ GY Sbjct: 522 PKSCPSIGGKECAG---HGVCTNEGKCACDPGY 551 >SB_41898| Best HMM Match : EGF_CA (HMM E-Value=3.9e-14) Length = 1087 Score = 29.9 bits (64), Expect = 1.1 Identities = 19/72 (26%), Positives = 30/72 (41%), Gaps = 4/72 (5%) Frame = +3 Query: 33 PDPFYQPHKPNQPDHHITPNRTNDLSSVQGGHVNGQNTQRFPECSEPC-INGVCTE---G 200 PD +Y KP ++ + +GG E S+PC +N CT Sbjct: 202 PDAYYAIVKPVTKCSNMFCSSGMTCKMREGGKTYKCEDLNECETSDPCHVNATCTNTVGS 261 Query: 201 NQCVCNPGYSMD 236 +C+C PG++ D Sbjct: 262 YECLCKPGFNGD 273 >SB_40708| Best HMM Match : SRCR (HMM E-Value=0) Length = 1976 Score = 29.9 bits (64), Expect = 1.1 Identities = 19/41 (46%), Positives = 22/41 (53%), Gaps = 3/41 (7%) Frame = +3 Query: 198 GNQC--VCNPGYSMDLTDRRCKPRCAGGCPNGLCSG-PNLC 311 GN+C VC GY D T R+C RC C CSG P+ C Sbjct: 78 GNKCLDVCGDGYYGDATSRKCL-RCDPICRT--CSGNPSNC 115 >SB_33576| Best HMM Match : Pentaxin (HMM E-Value=1.3e-06) Length = 799 Score = 29.9 bits (64), Expect = 1.1 Identities = 24/86 (27%), Positives = 36/86 (41%), Gaps = 7/86 (8%) Frame = +3 Query: 3 PNGTITYQPR--PDP-----FYQPHKPNQPDHHITPNRTNDLSSVQGGHVNGQNTQRFPE 161 P+GTIT P+P +Q + PN D H PN + ++ Q N T + Sbjct: 399 PSGTITLDQHNVPNPSGTITLHQHNVPNPSDRHKVPNPSGTITLHQHNVPNPSGTITLDQ 458 Query: 162 CSEPCINGVCTEGNQCVCNPGYSMDL 239 + P +G T V NP ++ L Sbjct: 459 HNVPNPSGTITLHQHNVPNPSGTITL 484 Score = 29.1 bits (62), Expect = 2.0 Identities = 23/80 (28%), Positives = 33/80 (41%), Gaps = 7/80 (8%) Frame = +3 Query: 3 PNGTITYQPR--PDP-----FYQPHKPNQPDHHITPNRTNDLSSVQGGHVNGQNTQRFPE 161 P+GTIT P+P +Q + PN D H PN + ++ Q N T + Sbjct: 348 PSGTITLDQHNVPNPSGTITLHQHNVPNPSDRHKVPNPSGTITLHQHNVPNPSGTITLDQ 407 Query: 162 CSEPCINGVCTEGNQCVCNP 221 + P +G T V NP Sbjct: 408 HNVPNPSGTITLHQHNVPNP 427 >SB_31541| Best HMM Match : EGF (HMM E-Value=0) Length = 268 Score = 29.9 bits (64), Expect = 1.1 Identities = 22/66 (33%), Positives = 30/66 (45%), Gaps = 9/66 (13%) Frame = +3 Query: 159 ECSE-PCING-VCTEGNQ---CVCNPGYSMDLTDRRCKPRCAGGCPNG-LCS-GPN--LC 311 EC++ PC NG C +G C C GY+ + +G C NG C+ G N C Sbjct: 79 ECADNPCANGGTCMDGINSFTCTCPAGYTGSKCETDIDDCASGPCQNGATCNDGVNKYTC 138 Query: 312 ICNMGY 329 C G+ Sbjct: 139 SCIPGF 144 Score = 29.1 bits (62), Expect = 2.0 Identities = 22/66 (33%), Positives = 29/66 (43%), Gaps = 9/66 (13%) Frame = +3 Query: 159 ECS-EPCING-VCTEGNQ---CVCNPGYSMDLTDRRCKPRCAGGCPNG-LCS-GPN--LC 311 EC+ PC NG C +G C C GY+ + +G C NG C+ G N C Sbjct: 3 ECAGNPCANGGTCMDGINSFTCTCPAGYTGSKCETDIDDCASGPCQNGATCNDGVNKFTC 62 Query: 312 ICNMGY 329 C G+ Sbjct: 63 SCIPGF 68 Score = 29.1 bits (62), Expect = 2.0 Identities = 22/66 (33%), Positives = 29/66 (43%), Gaps = 9/66 (13%) Frame = +3 Query: 159 ECS-EPCING-VCTEGNQ---CVCNPGYSMDLTDRRCKPRCAGGCPNG-LCS-GPN--LC 311 EC+ PC NG C +G C C GY+ + +G C NG C+ G N C Sbjct: 155 ECAGNPCANGGTCMDGINSFTCTCPAGYTGSKCETDIDDCASGPCQNGATCNDGVNKYTC 214 Query: 312 ICNMGY 329 C G+ Sbjct: 215 SCIPGF 220 >SB_46333| Best HMM Match : EGF (HMM E-Value=1.10001e-40) Length = 580 Score = 29.5 bits (63), Expect = 1.5 Identities = 22/81 (27%), Positives = 35/81 (43%), Gaps = 7/81 (8%) Frame = +3 Query: 174 CINGVCTEGNQCVCNPGYSMDLTDRRCKPRCAGGCP-NGLC------SGPNLCICNMGYH 332 CIN G C C+ G++ + + KP + C N C SG N C C+ G+ Sbjct: 133 CINDKDNSGYNCTCSAGFTGSDCETQVKPCDSSPCKNNATCTNKEDNSGYN-CTCSAGFT 191 Query: 333 KDTSVKGRAVCVKRIRRSLNY 395 + + V +R+ SL + Sbjct: 192 GNDCI--TQVIKERLTHSLTF 210 >SB_45709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1112 Score = 29.5 bits (63), Expect = 1.5 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +3 Query: 162 CSEPCINGVCTEGN-QCVCNPGYSMDLTDRRCK 257 CS+ C N T+G+ +C C GY ++ RRCK Sbjct: 675 CSQKCYN---TKGSFKCSCMEGYVLEPDGRRCK 704 >SB_41907| Best HMM Match : Reprolysin (HMM E-Value=9.2e-05) Length = 656 Score = 29.5 bits (63), Expect = 1.5 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +3 Query: 174 CINGVCTEGNQCVCNPGYSMDLTDRRCKPRCAGG-CPNG 287 CI+G C + + N G+S C C GG CP G Sbjct: 536 CISGECVDDGSPMINGGWSEWGNYSDCSHSCGGGACPEG 574 >SB_36411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 654 Score = 29.5 bits (63), Expect = 1.5 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 3/52 (5%) Frame = +3 Query: 183 GVCTEGNQCVCNPGY---SMDLTDRRCKPRCAGGCPNGLCSGPNLCICNMGY 329 G C +C CN G+ S + D +C+ +G C N C C+ GY Sbjct: 54 GSCVNAYRCECNSGWTGISCAVPDCAAVSQCSS---HGDCVASNTCRCHPGY 102 Score = 28.3 bits (60), Expect = 3.4 Identities = 19/66 (28%), Positives = 25/66 (37%), Gaps = 8/66 (12%) Frame = +3 Query: 156 PEC---SEPCINGVCTEGNQCVCNPGYSMDLTDRRCKPRCAGGCP-NGLC----SGPNLC 311 P+C S+ +G C N C C+PGY G C +G C G C Sbjct: 76 PDCAAVSQCSSHGDCVASNTCRCHPGYQGSRCSEVADCSSFGNCSFHGECVIDRGGNATC 135 Query: 312 ICNMGY 329 C G+ Sbjct: 136 RCYTGF 141 >SB_23044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2162 Score = 29.5 bits (63), Expect = 1.5 Identities = 24/65 (36%), Positives = 29/65 (44%), Gaps = 8/65 (12%) Frame = +3 Query: 159 EC-SEPCIN-GVCT--EGN-QCVCNPGYSMDLTDRRCKPRCAGGCPNGLC-SGPN--LCI 314 EC S PC N G C EG C C G++ + A GC NG C G N C Sbjct: 658 ECESNPCRNNGTCKNEEGKFTCTCLSGFNGTFCEVNIDDCPAIGCNNGTCIDGINNYTCQ 717 Query: 315 CNMGY 329 C +G+ Sbjct: 718 CFIGF 722 >SB_18417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 441 Score = 29.5 bits (63), Expect = 1.5 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 9/57 (15%) Frame = +3 Query: 162 CSEPCINGV---CTEGN--QCV--CNPGY-SMDLTDRRCKPRCA-GGCPNGLCSGPN 305 C++ C G C+ N C C G S + + C+ CA G CPN C G N Sbjct: 159 CNQDCTRGCQLDCSNENTADCTQECKTGSCSFNCAAQTCESSCAHGSCPNMTCGGTN 215 Score = 28.7 bits (61), Expect = 2.6 Identities = 17/65 (26%), Positives = 26/65 (40%) Frame = +3 Query: 159 ECSEPCINGVCTEGNQCVCNPGYSMDLTDRRCKPRCAGGCPNGLCSGPNLCICNMGYHKD 338 EC + C + CT + + PG ++ C CP G CS C+ + D Sbjct: 335 ECGKNCTSMACTAKSCELSCPGGGCIMSCSSSVENCTMSCPGGGCS--QHCVATGKCNFD 392 Query: 339 TSVKG 353 + KG Sbjct: 393 LNCKG 397 Score = 27.9 bits (59), Expect = 4.5 Identities = 13/48 (27%), Positives = 23/48 (47%), Gaps = 4/48 (8%) Frame = +3 Query: 162 CSEPCINGVCTE--GNQCVCNPGYSMDLTDRRC--KPRCAGGCPNGLC 293 C++ C++G CT+ N C + + T+ C +C C +G C Sbjct: 82 CNQRCLSGGCTDVACNSHTCLQTCTSNCTNMECHSNTKCTQECEDGAC 129 >SB_11794| Best HMM Match : TNFR_c6 (HMM E-Value=1.4e-05) Length = 331 Score = 29.5 bits (63), Expect = 1.5 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 4/46 (8%) Frame = +3 Query: 3 PNGTITYQPRPD--PFYQPHK--PNQPDHHITPNRTNDLSSVQGGH 128 P T +P P P P P+ P +H T NRTN V GH Sbjct: 215 PTANPTSKPMPQLPPTSPPSTTTPSMPANHTTDNRTNSADLVPSGH 260 >SB_5000| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 1050 Score = 29.1 bits (62), Expect = 2.0 Identities = 20/69 (28%), Positives = 31/69 (44%) Frame = +3 Query: 159 ECSEPCINGVCTEGNQCVCNPGYSMDLTDRRCKPRCAGGCPNGLCSGPNLCICNMGYHKD 338 +CS+ C+N V C C PGY + ++ C+ C N LC +MG + Sbjct: 749 KCSDSCLNTVGFYN--CGCPPGYKLMSDEKTCQD--VDECEN----AAQLCPLDMGL-QC 799 Query: 339 TSVKGRAVC 365 + KG +C Sbjct: 800 MNTKGSYIC 808 >SB_31262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 29.1 bits (62), Expect = 2.0 Identities = 14/54 (25%), Positives = 23/54 (42%) Frame = +3 Query: 51 PHKPNQPDHHITPNRTNDLSSVQGGHVNGQNTQRFPECSEPCINGVCTEGNQCV 212 P P+ P T +R + S +GG + T++ C NG T +C+ Sbjct: 226 PSTPSTPSTITTSSRASSRGSARGGAKTTKTTKKCTTCKSRGQNGDTTTKTKCI 279 >SB_19665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 491 Score = 29.1 bits (62), Expect = 2.0 Identities = 28/84 (33%), Positives = 33/84 (39%), Gaps = 16/84 (19%) Frame = +3 Query: 135 GQNTQRFPECS----EPCI-NGVC--TEGNQ-CVCNPGYSMDLTDRRCKPRCA--GGCP- 281 G+ EC+ PC N C T G+ C C PGY+ D CA G P Sbjct: 157 GEKCSDIDECAVSGDSPCDKNAECNNTVGSYTCTCKPGYTGDRKTCNDIDECAISGDSPC 216 Query: 282 --NGLCS---GPNLCICNMGYHKD 338 N C+ G C CN GY D Sbjct: 217 DKNAECNNTVGSYTCTCNPGYTGD 240 >SB_4238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1288 Score = 29.1 bits (62), Expect = 2.0 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = +3 Query: 198 GNQCVCNPGYSMDLTD-RRCKPRCAGGCPNGLCSGPNLCICNMGYHKDTSVKG 353 G C C PGY + L D + C+ P G CS +C + G +K T ++G Sbjct: 847 GYFCSCRPGYKVALDDPKSCRDVDECAIP-GSCS--QMCFNSKGSYKCTCMEG 896 >SB_64| Best HMM Match : Rho_N (HMM E-Value=1.8e-07) Length = 320 Score = 29.1 bits (62), Expect = 2.0 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +3 Query: 3 PNGTITY-QPRPDPFYQPHKPNQPDHHITPNRTNDLSS 113 P I Y QP+P P + + PNQP I R N +SS Sbjct: 101 PRRNIPYPQPKPIPTPRKNTPNQPQKPIPAPRRNIVSS 138 >SB_58902| Best HMM Match : TNFR_c6 (HMM E-Value=0.032) Length = 397 Score = 28.7 bits (61), Expect = 2.6 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +3 Query: 162 CSEPCINGVCTEGNQCVCNPGYSMDLTDRRCK 257 CS C NQC+C GY M +D +CK Sbjct: 340 CSFSCHFACDVNTNQCICYYGYQM--SDNKCK 369 >SB_47176| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 471 Score = 28.7 bits (61), Expect = 2.6 Identities = 18/51 (35%), Positives = 23/51 (45%), Gaps = 7/51 (13%) Frame = +3 Query: 207 CVCNPGYSMDLTDRRCKPRCAGG---C-PNGLCS---GPNLCICNMGYHKD 338 C+CNPG+S D + C G C N C+ G C CN G+ D Sbjct: 86 CMCNPGFSGDGRECTDIDECVTGDHTCDKNARCNNTIGSYHCTCNPGFSGD 136 Score = 28.7 bits (61), Expect = 2.6 Identities = 19/51 (37%), Positives = 23/51 (45%), Gaps = 7/51 (13%) Frame = +3 Query: 207 CVCNPGYSMDLTDRRCKPRCAGG---C-PNGLCS---GPNLCICNMGYHKD 338 C CNPG+S D + CA G C N C+ G C CN G+ D Sbjct: 127 CTCNPGFSGDGRNCTDIDECATGDHTCDKNAKCNNTIGSYHCRCNPGFSGD 177 Score = 27.9 bits (59), Expect = 4.5 Identities = 18/51 (35%), Positives = 22/51 (43%), Gaps = 7/51 (13%) Frame = +3 Query: 207 CVCNPGYSMDLTDRRCKPRCAGG---C-PNGLCS---GPNLCICNMGYHKD 338 C CNPG+S D + C G C N C+ G C CN G+ D Sbjct: 209 CTCNPGFSGDGRNCTDIDECVTGDHTCDKNAKCNNTIGSYHCTCNPGFSGD 259 >SB_55657| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 868 Score = 28.7 bits (61), Expect = 2.6 Identities = 21/69 (30%), Positives = 31/69 (44%) Frame = +3 Query: 159 ECSEPCINGVCTEGNQCVCNPGYSMDLTDRRCKPRCAGGCPNGLCSGPNLCICNMGYHKD 338 +CS+ C+N V C C PGY + ++ C+ C N LC +MG + Sbjct: 524 KCSDSCLNTVGFYN--CGCPPGYKLMSDEKTCQD--VDECEN----AAQLCPPDMGL-QC 574 Query: 339 TSVKGRAVC 365 + KG VC Sbjct: 575 MNTKGSYVC 583 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 28.7 bits (61), Expect = 2.6 Identities = 20/59 (33%), Positives = 24/59 (40%), Gaps = 4/59 (6%) Frame = +3 Query: 156 PECSEPCINGVCTEGNQCVCNPGYSMDLTDRRCK---PR-CAGGCPNGLCSGPNLCICN 320 P CS C +C C S D + CK P+ C GCP CS N+C N Sbjct: 1692 PNCSAQSCGNFCPP--KC-CTSQLSKD-RQKECKESCPKVCGPGCPVQCCSDLNICPAN 1746 >SB_29649| Best HMM Match : Sushi (HMM E-Value=4.1e-18) Length = 214 Score = 28.7 bits (61), Expect = 2.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +3 Query: 162 CSEPCINGVCTEGNQCVCNPGYSMDLTDRRC 254 C C+N +C+CN G+SM+ R C Sbjct: 53 CQHTCVN--THRSFKCLCNRGFSMNSNGRNC 81 >SB_5780| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 263 Score = 28.7 bits (61), Expect = 2.6 Identities = 18/51 (35%), Positives = 23/51 (45%), Gaps = 7/51 (13%) Frame = +3 Query: 207 CVCNPGYSMDLTDRRCKPRCAGG---C-PNGLCS---GPNLCICNMGYHKD 338 C+CNPG+S D + C G C N C+ G C CN G+ D Sbjct: 102 CMCNPGFSGDGRECTDIDECVTGDHTCDKNAKCNNIIGSYHCTCNPGFSGD 152 Score = 28.3 bits (60), Expect = 3.4 Identities = 18/51 (35%), Positives = 22/51 (43%), Gaps = 7/51 (13%) Frame = +3 Query: 207 CVCNPGYSMDLTDRRCKPRCAGG---C-PNGLCS---GPNLCICNMGYHKD 338 C CNPG+S D + C G C N C G C+CN G+ D Sbjct: 61 CTCNPGFSGDGRNCTDIDECVTGDHTCDKNAKCDNTIGSYHCMCNPGFSGD 111 >SB_52403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 28.3 bits (60), Expect = 3.4 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 5/29 (17%) Frame = +3 Query: 159 EC-SEPCIN-GVCTE---GNQCVCNPGYS 230 EC S PC N G+C + G C+C PG+S Sbjct: 51 ECASTPCANNGLCVDKEGGFTCLCKPGFS 79 >SB_52319| Best HMM Match : Rho_N (HMM E-Value=1.8e-07) Length = 1458 Score = 28.3 bits (60), Expect = 3.4 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +3 Query: 3 PNGTITY-QPRPDPFYQPHKPNQPDHHITPNRTNDLSS 113 P I Y QP+P P + + PNQP I R N +SS Sbjct: 101 PRRNIPYPQPKPIPTPRKNIPNQPQKPIPAPRRNIVSS 138 >SB_47942| Best HMM Match : TSP_1 (HMM E-Value=0) Length = 2195 Score = 28.3 bits (60), Expect = 3.4 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = +3 Query: 75 HHITPNRT-NDLSS-VQGGHVNGQNTQRFPECSEPCINGVCTEGNQCVCNP 221 H T +T ND + GG+ N + F EC++ C NG T C NP Sbjct: 192 HRETQTKTCNDFPCPIHGGYSNWSS---FTECTKSCGNGTITRNRTCT-NP 238 >SB_32721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 637 Score = 28.3 bits (60), Expect = 3.4 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 5/36 (13%) Frame = +3 Query: 135 GQNTQRFPECSE-PCING-VCTE---GNQCVCNPGY 227 G + + +C PC NG CTE G QC C+ GY Sbjct: 429 GHDCEAEAQCKHAPCHNGGTCTELHDGFQCTCSSGY 464 >SB_30275| Best HMM Match : EGF_CA (HMM E-Value=1.3e-13) Length = 142 Score = 28.3 bits (60), Expect = 3.4 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 4/30 (13%) Frame = +3 Query: 159 ECSEPC-INGVCTE---GNQCVCNPGYSMD 236 E S PC +N CT +C+C PG++ D Sbjct: 105 ETSNPCHVNATCTNTMGSYECLCKPGFNGD 134 >SB_19455| Best HMM Match : Amino_oxidase (HMM E-Value=0.0003) Length = 658 Score = 28.3 bits (60), Expect = 3.4 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +3 Query: 144 TQRFPECSEPCIN-GVCTEGNQCVCN 218 TQ++ +C PCI G +GNQC CN Sbjct: 365 TQQWNQC--PCIRAGPTQQGNQCPCN 388 >SB_7289| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 278 Score = 28.3 bits (60), Expect = 3.4 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 7/48 (14%) Frame = +3 Query: 207 CVCNPGYSMDLTDRRCKPRCAGG---C-PNGLCS---GPNLCICNMGY 329 C+CNPG+S D + C G C N C+ G C+CN G+ Sbjct: 158 CMCNPGFSGDGRECTDIDECVTGDHTCDKNARCNNTIGSYHCMCNPGF 205 Score = 27.9 bits (59), Expect = 4.5 Identities = 18/51 (35%), Positives = 23/51 (45%), Gaps = 7/51 (13%) Frame = +3 Query: 207 CVCNPGYSMDLTDRRCKPRCAGG---C-PNGLCS---GPNLCICNMGYHKD 338 C CNPG+S D + C G C N C+ G C+CN G+ D Sbjct: 35 CTCNPGFSGDGINCTDIDECVTGDHTCDKNAKCNNTIGLYHCMCNPGFSGD 85 Score = 27.5 bits (58), Expect = 6.0 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 7/48 (14%) Frame = +3 Query: 207 CVCNPGYSMDLTDRRCKPRCAGG---C-PNGLCS---GPNLCICNMGY 329 C+CNPG+S D + C G C N C+ G C CN G+ Sbjct: 76 CMCNPGFSGDGRECTDIDECVTGDHTCDKNAKCNNTIGSYHCTCNPGF 123 >SB_5993| Best HMM Match : EGF_2 (HMM E-Value=9e-14) Length = 360 Score = 28.3 bits (60), Expect = 3.4 Identities = 22/66 (33%), Positives = 29/66 (43%), Gaps = 2/66 (3%) Frame = +3 Query: 174 CING-VCTEGNQCV-CNPGYSMDLTDRRCKPRCAGGCPNGLCSGPNLCICNMGYHKDTSV 347 C+NG C + C CN G+ D +C+ RC G C+G +C C G D V Sbjct: 162 CLNGGTCDRVSGCCECNSGWYGD----KCQYRCPPGRFGLYCAG--ICKCVNGESCD-PV 214 Query: 348 KGRAVC 365 G C Sbjct: 215 SGECYC 220 >SB_40275| Best HMM Match : Cadherin (HMM E-Value=0) Length = 1747 Score = 28.3 bits (60), Expect = 3.4 Identities = 21/66 (31%), Positives = 27/66 (40%), Gaps = 1/66 (1%) Frame = +3 Query: 63 NQPDHHITPNRTNDLSSVQGGHVNGQNTQRFPEC-SEPCINGVCTEGNQCVCNPGYSMDL 239 N D+H + N L V Q PEC ++ + + CVCNPGYS Sbjct: 1210 NIKDNHNLYDLKNPLKVVNAPE-GCQLASACPECKNDGYCEPLMARDSICVCNPGYSGKH 1268 Query: 240 TDRRCK 257 D R K Sbjct: 1269 CDGRGK 1274 >SB_37171| Best HMM Match : EGF (HMM E-Value=2.6e-15) Length = 186 Score = 28.3 bits (60), Expect = 3.4 Identities = 23/85 (27%), Positives = 35/85 (41%), Gaps = 14/85 (16%) Frame = +3 Query: 141 NTQRFPEC-SEPCINGV-CTE-----GNQCVCNPGYSMDLTDRRCKPRCAGGCP-NGLCS 296 N+ R C S PC N CT G C C+ G++ + + KP + C N C+ Sbjct: 73 NSARVKPCDSSPCQNNATCTNKEDNSGYNCTCSTGFTGSDCETQVKPCGSSPCKNNSTCT 132 Query: 297 GPNL-----CICNMGY-HKDTSVKG 353 + C C+ G+ D +G Sbjct: 133 NKDENSGYDCTCSTGFTESDCETQG 157 >SB_52309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 27.9 bits (59), Expect = 4.5 Identities = 25/81 (30%), Positives = 34/81 (41%), Gaps = 7/81 (8%) Frame = +3 Query: 132 NGQNTQRFPEC---SEPCI-NGVC--TEGN-QCVCNPGYSMDLTDRRCKPRCAGGCPNGL 290 +G+N EC + C N C T G+ C+CNPG+S + + C G N Sbjct: 91 DGRNCTDIDECVTGNHTCDKNAKCNNTIGSYHCMCNPGFSGNGRNCTDIDECVTG--NHA 148 Query: 291 CSGPNLCICNMGYHKDTSVKG 353 C C N+G H T G Sbjct: 149 CDKNARCRNNIGSHHCTCKSG 169 Score = 27.5 bits (58), Expect = 6.0 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 7/48 (14%) Frame = +3 Query: 207 CVCNPGYSMDLTDRRCKPRCAGG---C-PNGLCS---GPNLCICNMGY 329 C CNPG+S D + C G C N C+ G C+CN G+ Sbjct: 82 CTCNPGFSGDGRNCTDIDECVTGNHTCDKNAKCNNTIGSYHCMCNPGF 129 >SB_38935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 281 Score = 27.9 bits (59), Expect = 4.5 Identities = 16/49 (32%), Positives = 21/49 (42%), Gaps = 4/49 (8%) Frame = +3 Query: 204 QCVCNPGYSMDLTDRRCKPRCAGGC-PNGLC---SGPNLCICNMGYHKD 338 +C C + D + C GC PN C SG N C+C G+ D Sbjct: 10 KCTCKLRFVGDGVVCIARGVCVPGCSPNAQCVAISGRNECVCMPGFQGD 58 >SB_28272| Best HMM Match : EGF (HMM E-Value=2.6e-15) Length = 157 Score = 27.9 bits (59), Expect = 4.5 Identities = 21/76 (27%), Positives = 32/76 (42%), Gaps = 13/76 (17%) Frame = +3 Query: 141 NTQRFPEC-SEPCINGV-CTE-----GNQCVCNPGYSMDLTDRRCKPRCAGGCP-NGLCS 296 N+ R C S PC N CT G C C+ G++ + + KP + C N C+ Sbjct: 73 NSARVKPCDSSPCQNNATCTNKEDNSGYNCTCSTGFTGSDCETQVKPCGSSPCKNNSTCT 132 Query: 297 GPNL-----CICNMGY 329 + C C+ G+ Sbjct: 133 NKDENSGYDCTCSTGF 148 >SB_39378| Best HMM Match : VWA (HMM E-Value=0) Length = 2865 Score = 27.9 bits (59), Expect = 4.5 Identities = 24/110 (21%), Positives = 42/110 (38%), Gaps = 6/110 (5%) Frame = +3 Query: 24 QPRPDPFYQPHKPNQPDHHITPNRTNDLSSVQGGHVNGQNTQRFPECSEPCIN-GVC--- 191 + R DP + + + H+ DL + G + P S+PC N G C Sbjct: 371 EDRNDPLVRDVASDPKEDHLFTPSLEDLEPSLPEILEGVIAEPDPCLSKPCANGGTCSPI 430 Query: 192 TEGNQ--CVCNPGYSMDLTDRRCKPRCAGGCPNGLCSGPNLCICNMGYHK 335 + G+ C C GY T + C + +C+ +C+ G ++ Sbjct: 431 SSGSDYTCACAAGY----TGKNCTADIDECLDSRICAVERMCVNTYGSYQ 476 >SB_34310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1103 Score = 27.9 bits (59), Expect = 4.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +3 Query: 207 CVCNPGYSMDLTDRRCKPRCAGGCPNGLC 293 C C PGY +D + RC CP+G C Sbjct: 270 CKCPPGYKLDESQARCTL-----CPDGNC 293 >SB_17518| Best HMM Match : F5_F8_type_C (HMM E-Value=1e-29) Length = 213 Score = 27.9 bits (59), Expect = 4.5 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +3 Query: 174 CINGVCTEGNQCVCNPGYSMDLTDRRCKPRC 266 C+ + QCVC+P Y+ RRC+ RC Sbjct: 27 CVGIPDEQSQQCVCSPDYA----GRRCEIRC 53 >SB_41405| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 2639 Score = 27.5 bits (58), Expect = 6.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 3 PNGTITYQPRPDPFYQPHKP 62 P+ Y+P PDP PH+P Sbjct: 70 PSKIAAYEPTPDPSRPPHRP 89 >SB_40529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1437 Score = 27.5 bits (58), Expect = 6.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 3 PNGTITYQPRPDPFYQPHKP 62 P+ Y+P PDP PH+P Sbjct: 371 PSKIAAYEPTPDPSRPPHRP 390 >SB_28495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6753 Score = 27.5 bits (58), Expect = 6.0 Identities = 25/71 (35%), Positives = 28/71 (39%), Gaps = 12/71 (16%) Frame = +3 Query: 153 FPEC-SEPCINGV-CTEG-----NQCVCNPGY----SMDLTDRRCKPRCAGG-CPNGLCS 296 F C S+PC G CT C C PGY D+ + KP GG C N Sbjct: 336 FEPCDSKPCGAGATCTHNLVAWNYTCACKPGYYGDNCADIDECTNKPCLNGGSCTN--LQ 393 Query: 297 GPNLCICNMGY 329 G C C GY Sbjct: 394 GDYRCSCVSGY 404 Score = 27.1 bits (57), Expect = 7.9 Identities = 12/39 (30%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +3 Query: 168 EPCINGVCTEGNQCVCNPG-YSMDLTDRRCKPRCAGGCP 281 + C N CT G C+ PG Y D ++ C P Sbjct: 2576 DECFNDPCTNGGACINLPGDYECDCPNKYTGKNCEKRTP 2614 >SB_9653| Best HMM Match : Retrotrans_gag (HMM E-Value=0.05) Length = 626 Score = 27.5 bits (58), Expect = 6.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 3 PNGTITYQPRPDPFYQPHKP 62 P+ Y+P PDP PH+P Sbjct: 287 PSKIAAYEPTPDPSRPPHRP 306 >SB_57101| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 855 Score = 27.5 bits (58), Expect = 6.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 3 PNGTITYQPRPDPFYQPHKP 62 P+ Y+P PDP PH+P Sbjct: 151 PSKIAAYEPTPDPSRPPHRP 170 >SB_18656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3292 Score = 27.5 bits (58), Expect = 6.0 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 10/63 (15%) Frame = +3 Query: 168 EPCINGVCT------EGNQCVCNPGYSMDLTDRR----CKPRCAGGCPNGLCSGPNLCIC 317 +PC NG C +G +C C P Y+ + + R C+ + GLC GP C C Sbjct: 1952 KPCQNGNCELSSATPKGYKCKCPPQYTGEYCETRKETPCQDKFFSASNIGLC-GP--CNC 2008 Query: 318 NMG 326 +G Sbjct: 2009 PVG 2011 >SB_16935| Best HMM Match : Cadherin (HMM E-Value=0) Length = 2204 Score = 27.5 bits (58), Expect = 6.0 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +3 Query: 162 CSEPCINGVCTEGNQCVCNPGYSMDLTDRRCKPRCAGGCPNG 287 C + C+N V + C+C GY + R C+ R G P G Sbjct: 84 CEQHCMNTVGSY--TCICELGYKLGQNGRSCE-RVDCGIPEG 122 >SB_9494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 670 Score = 27.5 bits (58), Expect = 6.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 3 PNGTITYQPRPDPFYQPHKP 62 P+ Y+P PDP PH+P Sbjct: 167 PSKIAAYEPTPDPSRPPHRP 186 >SB_50338| Best HMM Match : TNFR_c6 (HMM E-Value=1.4e-05) Length = 374 Score = 27.1 bits (57), Expect = 7.9 Identities = 16/45 (35%), Positives = 19/45 (42%), Gaps = 4/45 (8%) Frame = +3 Query: 3 PNGTITYQPRPD-PFYQPHK---PNQPDHHITPNRTNDLSSVQGG 125 P T +P P P P P+ P +H T NRTN V G Sbjct: 160 PTAKPTSKPMPQLPLTSPPSTTTPSMPANHTTENRTNSADLVPSG 204 >SB_47663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1409 Score = 27.1 bits (57), Expect = 7.9 Identities = 21/86 (24%), Positives = 34/86 (39%) Frame = +3 Query: 105 LSSVQGGHVNGQNTQRFPECSEPCINGVCTEGNQCVCNPGYSMDLTDRRCKPRCAGGCPN 284 ++S+ GG+ G N +C NG+ E +C C D+ C+P + Sbjct: 290 VTSMCGGNSAGVNMAINAQCG----NGIREENEECDCGTPEMCAAKDQCCEPHGCRLKRH 345 Query: 285 GLCSGPNLCICNMGYHKDTSVKGRAV 362 +CS + C +K RAV Sbjct: 346 AVCSDLHHSCCENCQYKLQGTLCRAV 371 >SB_44915| Best HMM Match : VWA (HMM E-Value=0) Length = 541 Score = 27.1 bits (57), Expect = 7.9 Identities = 26/107 (24%), Positives = 39/107 (36%), Gaps = 6/107 (5%) Frame = +3 Query: 24 QPRPDPFYQPHKPNQPDHHITPNRTNDLSSVQGGHVNGQNTQRFPECSEPCIN-GVC--- 191 + R DP + + + H+ DL + G + P S+PC N G C Sbjct: 220 EDRNDPLVRDVASDPKEDHLFTPSLEDLEPSLPEILEGVIAEPDPCLSKPCANGGTCSPI 279 Query: 192 TEGNQ--CVCNPGYSMDLTDRRCKPRCAGGCPNGLCSGPNLCICNMG 326 + G+ C C GY T + C C + C CI +G Sbjct: 280 SSGSDYTCACAAGY----TGKNCTAD-VDECSSSPCQNGASCIKKVG 321 >SB_43504| Best HMM Match : Urotensin_II (HMM E-Value=0.05) Length = 444 Score = 27.1 bits (57), Expect = 7.9 Identities = 15/54 (27%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = +3 Query: 174 CINGVC--TEGNQCVCNPGYSMDLTDRRCKPRCAGGCPNGLCSGPNLCICNMGY 329 C+NG C C C + D + C+ C NG C + C GY Sbjct: 324 CMNGYCRYVSTYDCYCRYVSTYDCMNGYCRYVSTYDCMNGYCRYVSTYDCMNGY 377 >SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) Length = 3922 Score = 27.1 bits (57), Expect = 7.9 Identities = 10/28 (35%), Positives = 15/28 (53%), Gaps = 2/28 (7%) Frame = +3 Query: 252 CKPRC--AGGCPNGLCSGPNLCICNMGY 329 C C G C L +G ++C+C+ GY Sbjct: 3063 CPNNCNDKGYCEPSLMAGKSMCVCDFGY 3090 >SB_13163| Best HMM Match : VWA (HMM E-Value=2.3e-32) Length = 318 Score = 27.1 bits (57), Expect = 7.9 Identities = 26/107 (24%), Positives = 39/107 (36%), Gaps = 6/107 (5%) Frame = +3 Query: 24 QPRPDPFYQPHKPNQPDHHITPNRTNDLSSVQGGHVNGQNTQRFPECSEPCIN-GVC--- 191 + R DP + + + H+ DL + G + P S+PC N G C Sbjct: 16 EDRNDPLVRDVASDPKEDHLFTPSLEDLEPSLPEILEGVIAEPDPCLSKPCANGGTCSPI 75 Query: 192 TEGNQ--CVCNPGYSMDLTDRRCKPRCAGGCPNGLCSGPNLCICNMG 326 + G+ C C GY T + C C + C CI +G Sbjct: 76 SSGSDYTCACAAGY----TGKNCTAD-VDECSSSPCQNGASCIKKVG 117 >SB_39781| Best HMM Match : cNMP_binding (HMM E-Value=2.2e-19) Length = 1211 Score = 27.1 bits (57), Expect = 7.9 Identities = 19/44 (43%), Positives = 20/44 (45%), Gaps = 6/44 (13%) Frame = -1 Query: 364 HTARPFTLVSLW*PMLQMQRL-----GPEQ-SPLGHPPAQRGLH 251 H RPF L P Q L P Q SP+ HPPAQ LH Sbjct: 442 HIPRPFNQALLHVPHTFNQALLHSHPSPSQPSPVSHPPAQALLH 485 >SB_17371| Best HMM Match : EGF_CA (HMM E-Value=0.36) Length = 38 Score = 27.1 bits (57), Expect = 7.9 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 4/31 (12%) Frame = +3 Query: 174 CINGVCTE---GNQCVCNPGYSMDL-TDRRC 254 C NG C + G +CVCN GY + D +C Sbjct: 6 CPNGRCIDMPSGFRCVCNDGYILPTGRDNKC 36 >SB_12742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1077 Score = 27.1 bits (57), Expect = 7.9 Identities = 26/73 (35%), Positives = 32/73 (43%), Gaps = 13/73 (17%) Frame = +3 Query: 159 ECSEP--C-INGVC--TEGNQ-CVCNPGY--SMDL-TD-RRCKPRCAGGCPNGLCS---G 299 EC P C ++ C T G+ C CN G+ DL TD C + N LC G Sbjct: 522 ECQLPGSCHVHATCANTNGSHVCTCNKGFIGEGDLCTDIDECHQKAHLCNKNALCHNIPG 581 Query: 300 PNLCICNMGYHKD 338 C+C GYH D Sbjct: 582 SYKCMCLKGYHGD 594 >SB_6742| Best HMM Match : EGF_CA (HMM E-Value=5.40004e-41) Length = 653 Score = 27.1 bits (57), Expect = 7.9 Identities = 22/69 (31%), Positives = 31/69 (44%), Gaps = 6/69 (8%) Frame = +3 Query: 204 QCVCNPGYSMDLTDRRCKPR--CAGGCPNGLCSGPNLCICNMGYHKDTSVKGRA----VC 365 +C C GYSM+ ++C R CA P CS C +G ++ T G A C Sbjct: 477 KCQCPLGYSMNNEMKKCVDRDECAEDWP---CSKFAFCRNEIGTYRCTCKPGYAGDGKTC 533 Query: 366 VKRIRRSLN 392 VK + + N Sbjct: 534 VKDLASTQN 542 >SB_4548| Best HMM Match : WD40 (HMM E-Value=6.7e-35) Length = 844 Score = 27.1 bits (57), Expect = 7.9 Identities = 12/40 (30%), Positives = 16/40 (40%) Frame = +3 Query: 243 DRRCKPRCAGGCPNGLCSGPNLCICNMGYHKDTSVKGRAV 362 DR C G LC NLC+ Y + + RA+ Sbjct: 13 DRNAATLCHAGINKLLCENKNLCVYPRAYRRYARITTRAL 52 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,905,657 Number of Sequences: 59808 Number of extensions: 410919 Number of successful extensions: 1859 Number of sequences better than 10.0: 130 Number of HSP's better than 10.0 without gapping: 1231 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1793 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 994359969 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -