BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_A19 (513 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81554-1|CAB04506.1| 838|Caenorhabditis elegans Hypothetical pr... 30 1.1 AL033514-16|CAA22103.2| 465|Caenorhabditis elegans Hypothetical... 27 6.0 >Z81554-1|CAB04506.1| 838|Caenorhabditis elegans Hypothetical protein F57G4.1 protein. Length = 838 Score = 29.9 bits (64), Expect = 1.1 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = +3 Query: 12 FKKKLQYNI*VRYRSCIN*FSRLFREISSRRNP-KTENAVEFLS*NVQMFFSKVNFIS 182 +K+KLQY + Y+S IN S EI + K +N +EF ++ + S NFIS Sbjct: 43 YKQKLQYRQELCYKSTINGCS---LEIGGKEEIFKNQNFMEFFFSHLTIILSSTNFIS 97 >AL033514-16|CAA22103.2| 465|Caenorhabditis elegans Hypothetical protein Y75B8A.16 protein. Length = 465 Score = 27.5 bits (58), Expect = 6.0 Identities = 12/43 (27%), Positives = 26/43 (60%) Frame = +2 Query: 185 VKSGLYSIGLPVSPLNGKVVIFFYIIGSIMAT**RGVILSYTK 313 ++ G++ +G+P+ I F+++G I T RG++++ TK Sbjct: 332 IEIGVHWMGIPLDISFWSQYISFFLVGVIAVTSVRGLLITMTK 374 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,826,567 Number of Sequences: 27780 Number of extensions: 171383 Number of successful extensions: 283 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 281 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 282 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 985905834 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -