Samia BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I10A02NGRL0005_A19
         (513 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g66540.1 68418.m08389 expressed protein ; supported by full-L...    29   2.4  

>At5g66540.1 68418.m08389 expressed protein ; supported by
           full-Length cDNA gi:12057175 from [Arabidopsis thaliana]
          Length = 524

 Score = 28.7 bits (61), Expect = 2.4
 Identities = 11/30 (36%), Positives = 20/30 (66%)
 Frame = -2

Query: 119 LCLRITAAADFAKQPRKLIDTASVPNLNII 30
           LCL++ A + F   P+ +I+  S+PN++ I
Sbjct: 425 LCLKLDALSHFHFTPKPVIEEMSIPNVSAI 454


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,764,546
Number of Sequences: 28952
Number of extensions: 143083
Number of successful extensions: 188
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 188
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 188
length of database: 12,070,560
effective HSP length: 76
effective length of database: 9,870,208
effective search space used: 927799552
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)