BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_A18 (557 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51819| Best HMM Match : TGF_beta (HMM E-Value=1.9) 30 1.1 SB_6576| Best HMM Match : TPR_2 (HMM E-Value=1.2) 28 5.9 >SB_51819| Best HMM Match : TGF_beta (HMM E-Value=1.9) Length = 696 Score = 30.3 bits (65), Expect = 1.1 Identities = 28/100 (28%), Positives = 48/100 (48%), Gaps = 1/100 (1%) Frame = +2 Query: 218 DSLLTLPELYFKPATVAELVSYVELVANAAPKLPVLYYHIPSMSRVEIN-MPAFVKEATA 394 D L+ LPE Y++P + E V+ N+A + L+Y P++ V+++ M A T Sbjct: 1 DCLILLPEAYYRPTVLKEHVTN-PCEVNSADQ-HCLHYRYPNIDGVDVSTMSAESGRLTG 58 Query: 395 RISNFKGLKFTSNDLNEGAQVLRSLKEGQEMFLGADTLLA 514 R F S +L+ G Q + S+ + GA ++A Sbjct: 59 RRYQTLSPPFPSVELH-GQQNVLSIDVPSAVVSGAYMVIA 97 >SB_6576| Best HMM Match : TPR_2 (HMM E-Value=1.2) Length = 116 Score = 27.9 bits (59), Expect = 5.9 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 Query: 239 ELYFKPATVAELVSYVELVANAAPKLPVLYY 331 ELY K T E S ++LVAN K+ YY Sbjct: 10 ELYLKMETSGESFSLLQLVANDCYKMGQFYY 40 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,959,926 Number of Sequences: 59808 Number of extensions: 377678 Number of successful extensions: 871 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 820 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 871 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1300738331 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -