BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_A15 (460 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22072| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.46 SB_44788| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_1780| Best HMM Match : Retinin_C (HMM E-Value=7.1) 29 1.8 SB_56617| Best HMM Match : RVT_1 (HMM E-Value=0.04) 29 2.4 SB_9756| Best HMM Match : Cadherin (HMM E-Value=0) 29 2.4 SB_39497| Best HMM Match : zf-C3HC4 (HMM E-Value=5.1e-12) 28 4.3 SB_26795| Best HMM Match : Exo_endo_phos (HMM E-Value=6.3e-10) 28 4.3 SB_15881| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_10682| Best HMM Match : Pkinase (HMM E-Value=2.5e-07) 27 5.6 SB_19418| Best HMM Match : Mucin (HMM E-Value=0.024) 27 7.5 SB_37009| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_14565| Best HMM Match : YGGT (HMM E-Value=0.11) 27 9.9 SB_31134| Best HMM Match : Kinesin (HMM E-Value=0) 27 9.9 SB_28995| Best HMM Match : LicD (HMM E-Value=0.018) 27 9.9 SB_6204| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_5515| Best HMM Match : PspA_IM30 (HMM E-Value=0.14) 27 9.9 >SB_22072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 642 Score = 31.1 bits (67), Expect = 0.46 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +1 Query: 73 TRVSLTPLCNNTAVSITSNDSPPFNNAD 156 T+ S TP+C + A T+N SP N++D Sbjct: 570 TQSSATPMCQSGATDTTNNQSPAVNSSD 597 >SB_44788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 979 Score = 29.1 bits (62), Expect = 1.8 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +2 Query: 230 KRNAEVTSSAPS*INYSSKDNQTSSNTLTVSGTDP 334 + N +VT P ++YSS D+ N GT+P Sbjct: 820 RHNDDVTDKKPRLVDYSSADSSDHDNAADNKGTEP 854 >SB_1780| Best HMM Match : Retinin_C (HMM E-Value=7.1) Length = 317 Score = 29.1 bits (62), Expect = 1.8 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +1 Query: 25 DDDKMILITVVLSA-LVTRVSLTPLCNNTAVSITSNDSP 138 DDD L ++ A L S TPLC + + +I DSP Sbjct: 61 DDDPASLANIINEAFLAPMASFTPLCADASPTIPPTDSP 99 >SB_56617| Best HMM Match : RVT_1 (HMM E-Value=0.04) Length = 447 Score = 28.7 bits (61), Expect = 2.4 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +1 Query: 25 DDDKMILITVVLSALVTRV-SLTPLCNNTAVSITSNDSP 138 DDD L ++ A ++ + S TPLC + + +I DSP Sbjct: 111 DDDPASLANIINEAFLSPMASFTPLCADASPTIPPTDSP 149 >SB_9756| Best HMM Match : Cadherin (HMM E-Value=0) Length = 608 Score = 28.7 bits (61), Expect = 2.4 Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 1/78 (1%) Frame = +1 Query: 67 LVTRVSLTPLCNNTAVSITSNDSPPFNNADPVMQL-YNSVIVSDYKAAVKTTFQLEKECR 243 + T +P + V IT ND N+ PV + Y V+VS+Y +T +L Sbjct: 356 IATDNGTSPRSAHARVHITVND---VNDNRPVFEPPYYQVMVSEYAPVGQTILRLTVSDN 412 Query: 244 SDVISSVVNKLLLEGQPN 297 +S +N ++ G PN Sbjct: 413 DTAENSQLNLRVVSGDPN 430 >SB_39497| Best HMM Match : zf-C3HC4 (HMM E-Value=5.1e-12) Length = 558 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/41 (26%), Positives = 25/41 (60%) Frame = +1 Query: 4 IPSRRRIDDDKMILITVVLSALVTRVSLTPLCNNTAVSITS 126 +P RR +M+++ + +++R++L+P C+N S+ S Sbjct: 375 LPPLRRDYTHQMVVVAPLKVKMISRLTLSPTCSNKPHSLPS 415 >SB_26795| Best HMM Match : Exo_endo_phos (HMM E-Value=6.3e-10) Length = 609 Score = 27.9 bits (59), Expect = 4.3 Identities = 14/49 (28%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = +1 Query: 226 LEKECRSDVISSVVNKLLLE-GQPNVVEYAYSLWYRSGEDIVKVYFPIE 369 L RSD+ + L++E +PN + + WYR + VK++ E Sbjct: 245 LSHTLRSDLADPYLEMLIIEIKKPNTKPFLIATWYRPPKSSVKLFESFE 293 >SB_15881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 796 Score = 27.5 bits (58), Expect = 5.6 Identities = 19/92 (20%), Positives = 39/92 (42%), Gaps = 3/92 (3%) Frame = +1 Query: 25 DDDKMILITVVLSALVTRVSL-TPLCNNTAVSITSNDSPPFNNADPVMQL--YNSVIVSD 195 DDD L ++ A + ++ TPLC + + +I DSP + +L N+ + Sbjct: 290 DDDPASLANIINEAFLAPMAFFTPLCADASPTIPPTDSPSVTELGVLKKLSSLNTTKATR 349 Query: 196 YKAAVKTTFQLEKECRSDVISSVVNKLLLEGQ 291 + + + ++S++N EG+ Sbjct: 350 PDGVPGWLLKENADLLAPAVTSIINTSFAEGR 381 >SB_10682| Best HMM Match : Pkinase (HMM E-Value=2.5e-07) Length = 165 Score = 27.5 bits (58), Expect = 5.6 Identities = 15/55 (27%), Positives = 25/55 (45%) Frame = +1 Query: 232 KECRSDVISSVVNKLLLEGQPNVVEYAYSLWYRSGEDIVKVYFPIEFRLLFNEDP 396 K C + SV N G P++ +Y + WYR+ E ++ F +F +P Sbjct: 96 KICDFGLARSVSNITQEAGDPSLTDYVATRWYRAPEILLASPRKATFSWIFYIEP 150 >SB_19418| Best HMM Match : Mucin (HMM E-Value=0.024) Length = 1213 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/46 (28%), Positives = 25/46 (54%) Frame = +1 Query: 19 RIDDDKMILITVVLSALVTRVSLTPLCNNTAVSITSNDSPPFNNAD 156 +ID+ ++IL+T A S +C ++A + T+N +P N + Sbjct: 815 KIDNMEVILLTPTSMAASMATSSKKVCPSSAPTTTTNPTPSVTNGN 860 >SB_37009| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 100 NNTAVSITSNDSPPFNNADPVMQ 168 N+ AV T +PP NN DP+ + Sbjct: 388 NDLAVLYTQKKNPPMNNRDPLSE 410 >SB_14565| Best HMM Match : YGGT (HMM E-Value=0.11) Length = 357 Score = 26.6 bits (56), Expect = 9.9 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -2 Query: 156 VSIIKWRRVIGGNRDCSVVT*RCERNAG 73 +S++KW G DC+VV R E N G Sbjct: 1 MSLMKWMLDYGDKSDCNVVVVRKEDNDG 28 >SB_31134| Best HMM Match : Kinesin (HMM E-Value=0) Length = 727 Score = 26.6 bits (56), Expect = 9.9 Identities = 16/56 (28%), Positives = 23/56 (41%) Frame = +1 Query: 70 VTRVSLTPLCNNTAVSITSNDSPPFNNADPVMQLYNSVIVSDYKAAVKTTFQLEKE 237 V V L LC ++ S D F+ A + I+ D+K +K L KE Sbjct: 608 VNNVDLALLCTHSGSRDNSQDLYTFHEAVSQLNDIEDKIIDDHKCTIKEAKTLLKE 663 >SB_28995| Best HMM Match : LicD (HMM E-Value=0.018) Length = 1164 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +1 Query: 229 EKECRSDVISSVVNKLLLEGQ 291 EK CR ++ +N LLL+GQ Sbjct: 155 EKLCRGGIVLEYINNLLLKGQ 175 >SB_6204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 281 Score = 26.6 bits (56), Expect = 9.9 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +1 Query: 19 RIDDDKMILITVVLSALVTRVSLTPLCNNTAVS 117 RI+DD + I L+A T + LCNN S Sbjct: 179 RIEDDGAVAIAEALAAYNTNLIKLVLCNNNIAS 211 >SB_5515| Best HMM Match : PspA_IM30 (HMM E-Value=0.14) Length = 388 Score = 26.6 bits (56), Expect = 9.9 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -3 Query: 311 AYSTTFGCPSRSSLFTTELMTSLL 240 A S FGCPSRS++ T + S L Sbjct: 5 ARSARFGCPSRSNMLTLKFDKSSL 28 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,756,588 Number of Sequences: 59808 Number of extensions: 205784 Number of successful extensions: 505 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 473 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 503 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 932979724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -