BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_A14 (638 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 22 3.8 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 22 3.8 DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped prot... 21 6.6 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 21 8.7 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 22.2 bits (45), Expect = 3.8 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = +2 Query: 455 TRTSALGVDRTYNSASHNESFSFHCKLQILFFSYQYCVVSLCL 583 T +S + + T + ++ NES S I S +C++ +CL Sbjct: 39 TPSSTIDLYNTSSVSNFNESSSSVFPNYIRTTSMVFCIIIMCL 81 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 22.2 bits (45), Expect = 3.8 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = +2 Query: 455 TRTSALGVDRTYNSASHNESFSFHCKLQILFFSYQYCVVSLCL 583 T +S + + T + ++ NES S I S +C++ +CL Sbjct: 39 TPSSTIDLYNTSSVSNFNESSSSVFPNYIRTTSMVFCIIIMCL 81 >DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped protein. Length = 126 Score = 21.4 bits (43), Expect = 6.6 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = -2 Query: 364 TKIYNYILHSKIKITNRFVCCVLAG 290 TK YN ++H + R C + G Sbjct: 90 TKSYNLLIHERTHTDERPYSCDICG 114 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.0 bits (42), Expect = 8.7 Identities = 7/28 (25%), Positives = 14/28 (50%) Frame = -1 Query: 509 RCDSRYYTSCLHPERRFWCILPRLRCSL 426 +C CL R C++P ++C++ Sbjct: 239 KCQECRLKKCLSVGMRPECVVPEVQCAV 266 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,670 Number of Sequences: 336 Number of extensions: 2687 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16501678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -