BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_A14 (638 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_1576| Best HMM Match : bZIP_1 (HMM E-Value=1.1e-11) 81 7e-16 SB_59208| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_1224| Best HMM Match : bZIP_1 (HMM E-Value=8e-10) 53 2e-07 SB_41031| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_58135| Best HMM Match : bZIP_1 (HMM E-Value=1.4e-09) 46 2e-05 SB_20196| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_41032| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_56664| Best HMM Match : bZIP_1 (HMM E-Value=0.00033) 36 0.021 SB_11068| Best HMM Match : bZIP_1 (HMM E-Value=9.2) 36 0.037 SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) 35 0.064 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 35 0.064 SB_55988| Best HMM Match : bZIP_1 (HMM E-Value=7.4e-06) 34 0.085 SB_43304| Best HMM Match : bZIP_Maf (HMM E-Value=1e-05) 34 0.11 SB_37872| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_9266| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_51620| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_32179| Best HMM Match : DUF1409 (HMM E-Value=0.071) 33 0.26 SB_35764| Best HMM Match : RVT_1 (HMM E-Value=8.1e-13) 32 0.34 SB_56783| Best HMM Match : YicC_N (HMM E-Value=8.6e-07) 31 0.79 SB_11657| Best HMM Match : bZIP_2 (HMM E-Value=3e-16) 31 0.79 SB_44702| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.03) 31 1.0 SB_8304| Best HMM Match : PLAT (HMM E-Value=0) 31 1.0 SB_58660| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 30 1.8 SB_49860| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) 29 3.2 SB_11683| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_22224| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_42963| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_16005| Best HMM Match : bZIP_Maf (HMM E-Value=5.6e-32) 29 4.2 SB_48008| Best HMM Match : M (HMM E-Value=0.0068) 29 4.2 SB_22570| Best HMM Match : Filament (HMM E-Value=0.1) 29 4.2 SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) 28 5.6 SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) 28 5.6 SB_41880| Best HMM Match : TolA (HMM E-Value=2.2) 28 5.6 SB_30749| Best HMM Match : FARP (HMM E-Value=0.032) 28 5.6 SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_50330| Best HMM Match : 7tm_1 (HMM E-Value=3.9e-17) 28 7.4 SB_11738| Best HMM Match : SH3_2 (HMM E-Value=3.7e-32) 28 7.4 SB_31791| Best HMM Match : PIG-U (HMM E-Value=0.15) 28 7.4 SB_54664| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_53556| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 27 9.7 SB_54574| Best HMM Match : WD40 (HMM E-Value=0) 27 9.7 SB_42708| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_32768| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 >SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 92.7 bits (220), Expect = 2e-19 Identities = 42/77 (54%), Positives = 58/77 (75%) Frame = +2 Query: 2 DMDSQERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKDHV 181 D+D QE +K ERK+ RNR+AASKCR+RKLE+ ++LEDKVK+LK +N +L +L+ V Sbjct: 126 DLDLQEAVKNERKKLRNRLAASKCRKRKLEKEAELEDKVKVLKDKNTKLVSEAQELRRLV 185 Query: 182 HRLKEQVLEHANGGCHI 232 LKEQV+ H +GGC + Sbjct: 186 CELKEQVMNHVSGGCQV 202 >SB_1576| Best HMM Match : bZIP_1 (HMM E-Value=1.1e-11) Length = 382 Score = 81.0 bits (191), Expect = 7e-16 Identities = 39/77 (50%), Positives = 56/77 (72%) Frame = +2 Query: 2 DMDSQERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKDHV 181 D++ QE +K ERK+Q+NRVAASKCRR+KLER ++LE +V+ LK ++ EL + L+ V Sbjct: 298 DLELQEIVKRERKKQKNRVAASKCRRKKLEREAQLEVRVQQLKEKSIELNAVASALRQQV 357 Query: 182 HRLKEQVLEHANGGCHI 232 LK++VLEH GC + Sbjct: 358 GELKQRVLEHVAFGCQL 374 >SB_59208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 79.0 bits (186), Expect = 3e-15 Identities = 37/72 (51%), Positives = 54/72 (75%) Frame = +2 Query: 2 DMDSQERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKDHV 181 D++ QE +K ERK+QRNR+A+SKCR+RKLER ++LE++VK LK N EL + LK V Sbjct: 467 DLEIQEVVKRERKKQRNRIASSKCRKRKLEREARLENRVKDLKERNIELNAVANALKQQV 526 Query: 182 HRLKEQVLEHAN 217 LK++V++H + Sbjct: 527 CDLKQRVMDHVD 538 >SB_1224| Best HMM Match : bZIP_1 (HMM E-Value=8e-10) Length = 496 Score = 53.2 bits (122), Expect = 2e-07 Identities = 23/66 (34%), Positives = 44/66 (66%) Frame = +2 Query: 17 ERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKDHVHRLKE 196 E +K+ R+RQRN+ AAS+CR ++ +R+ +L+ + L+ +NAE+ + + L+ + L+ Sbjct: 286 EELKIIRRRQRNKQAASRCREKRRQRLEELQREATELEEQNAEVERDIATLRVEYNELEA 345 Query: 197 QVLEHA 214 + EHA Sbjct: 346 LLTEHA 351 >SB_41031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 47.2 bits (107), Expect = 1e-05 Identities = 23/69 (33%), Positives = 42/69 (60%) Frame = +2 Query: 8 DSQERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKDHVHR 187 + +ER KL +R+RN+VAASKCR+++ + + L + L+ +N L + KL D + + Sbjct: 96 EEEERRKL--RRERNKVAASKCRQKRKQHVRNLVQVSEALEVQNNTLQSQITKLHDEIKQ 153 Query: 188 LKEQVLEHA 214 L+ + H+ Sbjct: 154 LEFMLDSHS 162 >SB_58135| Best HMM Match : bZIP_1 (HMM E-Value=1.4e-09) Length = 275 Score = 46.4 bits (105), Expect = 2e-05 Identities = 26/86 (30%), Positives = 49/86 (56%), Gaps = 6/86 (6%) Frame = +2 Query: 2 DMDSQERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKDHV 181 ++ E K +R+RN++AA KCR+R+ E I +LE + + ++ N EL + + +L + Sbjct: 167 ELSPAELEKRRIRRERNKLAAFKCRQRRKEHIQELEIESEGIEDSNKELEREISELHEQR 226 Query: 182 HRLKEQVLEHA------NGGCHIESH 241 +L+E + H+ NGG +S+ Sbjct: 227 QQLEEMLKTHSCKLSNNNGGSRTKSN 252 >SB_20196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 297 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/50 (40%), Positives = 32/50 (64%) Frame = +2 Query: 26 KLERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKD 175 K E + +NR AA +CRR+K E + LE++V +L+ +N L + + LKD Sbjct: 241 KREMRLMKNREAAKECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKD 290 >SB_41032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/70 (28%), Positives = 38/70 (54%) Frame = +2 Query: 2 DMDSQERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKDHV 181 ++ +E + + +RQRN+VAASKCR ++ E + L + L+ N++L + L Sbjct: 78 ELTPEEETRRKVRRQRNKVAASKCRLKRREHVKNLLKASEELESANSKLESDIACLNAEK 137 Query: 182 HRLKEQVLEH 211 +L+ + H Sbjct: 138 EQLERMLDAH 147 >SB_56664| Best HMM Match : bZIP_1 (HMM E-Value=0.00033) Length = 652 Score = 36.3 bits (80), Expect = 0.021 Identities = 17/56 (30%), Positives = 36/56 (64%), Gaps = 1/56 (1%) Frame = +2 Query: 8 DSQER-IKLERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLK 172 D+Q + ++ R+R +N+ AA CR+RK++ I L+D++ LK + + ++ ++K Sbjct: 413 DAQAKYVRDVRRRGKNKEAARICRKRKMDAIETLDDEITRLKQQRQSMFELDGEVK 468 >SB_11068| Best HMM Match : bZIP_1 (HMM E-Value=9.2) Length = 106 Score = 35.5 bits (78), Expect = 0.037 Identities = 14/35 (40%), Positives = 24/35 (68%) Frame = +2 Query: 2 DMDSQERIKLERKRQRNRVAASKCRRRKLERISKL 106 ++ +E + + +RQRN+VAASKCR ++ E + L Sbjct: 70 ELTPEEETRRKVRRQRNKVAASKCRLKRREHVKNL 104 >SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) Length = 3489 Score = 34.7 bits (76), Expect = 0.064 Identities = 22/64 (34%), Positives = 38/64 (59%), Gaps = 1/64 (1%) Frame = +2 Query: 14 QERI-KLERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKDHVHRL 190 ++RI LE++ R+++ S+ L +L+++ K LK E+ ELA+ KLKD + L Sbjct: 1918 EQRIASLEKEASRSQMTGSE--GEVLTENDRLKEENKTLKEEHTELAEQNEKLKDALEEL 1975 Query: 191 KEQV 202 +E V Sbjct: 1976 REAV 1979 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 34.7 bits (76), Expect = 0.064 Identities = 22/84 (26%), Positives = 43/84 (51%) Frame = +2 Query: 14 QERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKDHVHRLK 193 Q ++L +QR S R K ER KL ++ ++K NA+ M ++++ RL+ Sbjct: 764 QLHVELTNIKQRLAETESASSRLKGER-EKLHKELTVMKENNAQWKDMCERIQEDKERLQ 822 Query: 194 EQVLEHANGGCHIESHF*SRCRRL 265 +++++ +ES F S +R+ Sbjct: 823 KEMIDLQKSMSKVESSFGSSQQRV 846 >SB_55988| Best HMM Match : bZIP_1 (HMM E-Value=7.4e-06) Length = 150 Score = 34.3 bits (75), Expect = 0.085 Identities = 19/45 (42%), Positives = 27/45 (60%) Frame = +2 Query: 20 RIKLERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQ 154 +I LE K +R+R +A +CR RK R LED V + E ++L Q Sbjct: 73 QIDLEAKLERSRQSARECRARKKLRYKCLEDTVTRKESEVSKLRQ 117 >SB_43304| Best HMM Match : bZIP_Maf (HMM E-Value=1e-05) Length = 96 Score = 33.9 bits (74), Expect = 0.11 Identities = 20/72 (27%), Positives = 41/72 (56%), Gaps = 4/72 (5%) Frame = +2 Query: 5 MDSQERIKLERKRQ--RNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKDH 178 +++ E ++L ++R+ +NR+ AS C+++++ E + +IL E L + K+K Sbjct: 4 LENSEIVRLRKRRRSLKNRIYASVCKKKRVAEQKTYEVQNRILVKERNTLKMELEKVKTE 63 Query: 179 VHRLKE--QVLE 208 ++KE Q LE Sbjct: 64 RDKIKEAYQTLE 75 >SB_37872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 357 Score = 33.1 bits (72), Expect = 0.20 Identities = 21/63 (33%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Frame = +2 Query: 17 ERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKI-LKGENAELAQMVVKLKDHVHRLK 193 ER++ E+K A ++ + L I +V I L+G+ E ++ VKL++ V+RLK Sbjct: 176 ERLESEQKEHAQAEAKTQKSEQFLRNIEAKSKQVIIALRGQLDEASEEKVKLEEEVNRLK 235 Query: 194 EQV 202 QV Sbjct: 236 NQV 238 >SB_9266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1490 Score = 33.1 bits (72), Expect = 0.20 Identities = 13/37 (35%), Positives = 24/37 (64%) Frame = +2 Query: 86 LERISKLEDKVKILKGENAELAQMVVKLKDHVHRLKE 196 L R+S LE++ +LK +NA L V+ L+ +H++ + Sbjct: 133 LRRVSSLEEENTVLKSKNAALTLEVLSLRAQIHKINQ 169 >SB_51620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 451 Score = 32.7 bits (71), Expect = 0.26 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 4/50 (8%) Frame = +2 Query: 11 SQERIKLERKR----QRNRVAASKCRRRKLERISKLEDKVKILKGENAEL 148 SQE + + +R +RNR AA++CR ++ + +LE K L N +L Sbjct: 368 SQEELDPDERRRKFLERNRAAATRCREKRKIWVQQLEKKADDLSNTNTQL 417 >SB_32179| Best HMM Match : DUF1409 (HMM E-Value=0.071) Length = 429 Score = 32.7 bits (71), Expect = 0.26 Identities = 17/42 (40%), Positives = 29/42 (69%) Frame = +2 Query: 89 ERISKLEDKVKILKGENAELAQMVVKLKDHVHRLKEQVLEHA 214 + I +LEDK++ LK EN++L Q++ K ++ + R+ E LE A Sbjct: 297 QSIEQLEDKIRELKQENSDLRQLLDKAEEKI-RIYEIDLEKA 337 >SB_35764| Best HMM Match : RVT_1 (HMM E-Value=8.1e-13) Length = 362 Score = 32.3 bits (70), Expect = 0.34 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = -1 Query: 227 GSRRSRAPTPAPSACERGLSTSPPSVRAPHSPLLKSSLCP 108 G+ S P P C+R + T PSV P S +SSL P Sbjct: 67 GAESSSMPDPVRKTCQRRVKTFHPSVDTPMSTFGRSSLGP 106 >SB_56783| Best HMM Match : YicC_N (HMM E-Value=8.6e-07) Length = 251 Score = 31.1 bits (67), Expect = 0.79 Identities = 12/26 (46%), Positives = 20/26 (76%) Frame = +2 Query: 128 KGENAELAQMVVKLKDHVHRLKEQVL 205 K +AE+ ++VV +KD + ++KEQVL Sbjct: 223 KSNHAEMQKLVVMMKDELEKIKEQVL 248 >SB_11657| Best HMM Match : bZIP_2 (HMM E-Value=3e-16) Length = 298 Score = 31.1 bits (67), Expect = 0.79 Identities = 17/56 (30%), Positives = 32/56 (57%) Frame = +2 Query: 8 DSQERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKD 175 D ++ + +R +N VAA + R + ++ ++ K K L+ ENA L + + +LKD Sbjct: 164 DQEKDDRYWARRVKNNVAARRSRDMRRQKEIEISMKWKQLEKENARLREELQQLKD 219 >SB_44702| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.03) Length = 307 Score = 30.7 bits (66), Expect = 1.0 Identities = 15/61 (24%), Positives = 36/61 (59%), Gaps = 3/61 (4%) Frame = +2 Query: 26 KLERKRQRNRVAASKCR---RRKLERISKLEDKVKILKGENAELAQMVVKLKDHVHRLKE 196 +LE + ++ +V+ + R L R++++E++ +L+ E+ + ++ KLK + +KE Sbjct: 86 ELEEESRKYKVSLQRSRVGDAIDLRRLAEVEEENTVLQAESRKQISLISKLKSDIKSIKE 145 Query: 197 Q 199 Q Sbjct: 146 Q 146 >SB_8304| Best HMM Match : PLAT (HMM E-Value=0) Length = 1182 Score = 30.7 bits (66), Expect = 1.0 Identities = 18/69 (26%), Positives = 36/69 (52%) Frame = +2 Query: 2 DMDSQERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKDHV 181 ++D + R E + +R+R + +RR+ E K ED+VK + + + +KL + Sbjct: 623 EIDDEMRKLEEERTERDRQKEEERKRREEEEKKKREDEVKREEEGRRQKVEAELKLIEDE 682 Query: 182 HRLKEQVLE 208 H+ + + LE Sbjct: 683 HKQRLEELE 691 >SB_58660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 960 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/48 (33%), Positives = 28/48 (58%) Frame = +2 Query: 32 ERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKD 175 ERKR++ A +C R ++E +L K ++L+ N +L + V L+D Sbjct: 648 ERKRRQEAELARQCHRNEIE---QLTFKTRLLEQSNTDLLRAVRSLED 692 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -1 Query: 209 APTPAPSACERGLSTSPPSVRAPHSP 132 APTP P + T PP RAP +P Sbjct: 95 APTPTPMVAQSVAPTPPPPPRAPETP 120 >SB_49860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 29.5 bits (63), Expect = 2.4 Identities = 16/66 (24%), Positives = 38/66 (57%), Gaps = 3/66 (4%) Frame = +2 Query: 8 DSQERIKLERKRQRNRVAASKCR---RRKLERISKLEDKVKILKGENAELAQMVVKLKDH 178 + QER++ +R+++ R+A + R +RK+E + L++ +K + + AE + K + Sbjct: 225 EEQERLEQQRRQREQRIAEKRKRLEEQRKVESLHLLKELLKRVADKRAEEEEEKRKREKE 284 Query: 179 VHRLKE 196 + L++ Sbjct: 285 LEMLRQ 290 >SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) Length = 1230 Score = 29.1 bits (62), Expect = 3.2 Identities = 26/84 (30%), Positives = 41/84 (48%), Gaps = 1/84 (1%) Frame = +2 Query: 14 QERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKDHVHRLK 193 ++++KLE R+RN +A ++KL I K+E KIL + + K+HV L+ Sbjct: 1107 KKKMKLEEDRKRNEIA-----KQKLASIRKIE---KILTFIETARWSAIKRAKEHVKSLQ 1158 Query: 194 EQVLEHANGGCH-IESHF*SRCRR 262 + LE H E+ R RR Sbjct: 1159 KGGLEIKKRDLHESENEIEKRRRR 1182 >SB_11683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 29.1 bits (62), Expect = 3.2 Identities = 21/48 (43%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = -1 Query: 269 RRGDGIAIRSAIRCGSR-RSRAPTPAPS-ACERGLSTSPPSVRAPHSP 132 RR + RS R GSR R R+P+ +P ER S SP R HSP Sbjct: 130 RRSPSLERRSRSRSGSRERRRSPSRSPERRRERSFSNSPK--RERHSP 175 >SB_22224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1106 Score = 29.1 bits (62), Expect = 3.2 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +2 Query: 2 DMDSQERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKILKG 133 + D Q+R K E KR+R + R++ E+ K K+ LKG Sbjct: 1004 ERDEQKRKKEEEKREREEKKRKEEERKRREKADKELKKIHKLKG 1047 >SB_42963| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -1 Query: 215 SRAPTPAPSACERGLSTSPPSVR 147 SRAPT +PS C + PPS R Sbjct: 310 SRAPTRSPSGCSSDSTNPPPSPR 332 >SB_16005| Best HMM Match : bZIP_Maf (HMM E-Value=5.6e-32) Length = 160 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +2 Query: 8 DSQERIKLERKRQRNRVAASKCRRRKLERISKLED 112 + Q RIK R+ +NR A CR +++ + LE+ Sbjct: 82 EEQSRIKYRRRTLKNRGYAHNCRIKRISQKKSLEE 116 >SB_48008| Best HMM Match : M (HMM E-Value=0.0068) Length = 1068 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +2 Query: 95 ISKLEDKVKILKGENAELAQMVVKLKDHVHRLKEQVLE 208 + LE VKIL+ +EL + + LK+ H L++ + E Sbjct: 563 VDSLEADVKILREHESELKKEMTSLKERNHNLEQMLNE 600 >SB_22570| Best HMM Match : Filament (HMM E-Value=0.1) Length = 601 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/49 (26%), Positives = 25/49 (51%) Frame = +2 Query: 29 LERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKD 175 L + +R +CRRR E ++ L+ K+K L+ + Q++ K+ Sbjct: 223 LNERLERKESTLMECRRRHDEELTSLQKKIKNLEERLSSTNQLISSTKN 271 >SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) Length = 1866 Score = 28.3 bits (60), Expect = 5.6 Identities = 16/65 (24%), Positives = 36/65 (55%), Gaps = 3/65 (4%) Frame = +2 Query: 14 QERIKLERKRQRNRVAASKCRRRK---LERISKLEDKVKILKGENAELAQMVVKLKDHVH 184 Q++++ E+K + ++ K +R K ER+ + E+K K + E A+ + + +D +H Sbjct: 928 QQQLEKEKKEKEKKLLIEKEKREKEKQKERLREKEEKEKQKEAERAKKEKERLLQEDKLH 987 Query: 185 RLKEQ 199 +E+ Sbjct: 988 EKEEK 992 >SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) Length = 1249 Score = 28.3 bits (60), Expect = 5.6 Identities = 19/64 (29%), Positives = 34/64 (53%) Frame = +2 Query: 8 DSQERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKDHVHR 187 + Q+ +K ER R+ A +R LE KLE++ K + + ELA++ K ++ R Sbjct: 191 ERQKALKEERMRKLQE-EARLAAQRALEEKRKLEEERKEQERKEKELAELEKKRQEERRR 249 Query: 188 LKEQ 199 +E+ Sbjct: 250 QEEK 253 >SB_41880| Best HMM Match : TolA (HMM E-Value=2.2) Length = 374 Score = 28.3 bits (60), Expect = 5.6 Identities = 17/62 (27%), Positives = 33/62 (53%) Frame = +2 Query: 11 SQERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKDHVHRL 190 +QE ++ ER+ + NR+ + R ++ E K ++ + GE+ E +KLK+ + Sbjct: 192 AQEEMRREREEEENRILEEEERVKREEEEKKAKEVEEKRMGEDEE----QIKLKEEEVEI 247 Query: 191 KE 196 KE Sbjct: 248 KE 249 >SB_30749| Best HMM Match : FARP (HMM E-Value=0.032) Length = 2565 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +2 Query: 14 QERIKLERKRQRNRVAASKCRRRKLERISKLEDK 115 Q R K RKR+R R + + RRR+ R S+L K Sbjct: 684 QRRRKRRRKRRRQRRSRRRRRRRRRRRRSQLRRK 717 >SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1711 Score = 28.3 bits (60), Expect = 5.6 Identities = 18/58 (31%), Positives = 29/58 (50%) Frame = +2 Query: 35 RKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKDHVHRLKEQVLE 208 +K+++ V + + K RIS LE +V +L NAEL + K H K + +E Sbjct: 272 KKKEKQEVESDL--KYKTARISTLEKEVAVLHQANAELKNKADRFK-HTEEEKNKAIE 326 Score = 27.5 bits (58), Expect = 9.7 Identities = 16/56 (28%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +2 Query: 17 ERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKI-LKGENAELAQMVVKLKDHV 181 E +KLER++ + + K + K+ER + + I + EN++L++ V L+ V Sbjct: 972 EEVKLERRKHQEELETLKDKTLKVERELRDSQQENIKMNIENSKLSRKVSSLESSV 1027 >SB_50330| Best HMM Match : 7tm_1 (HMM E-Value=3.9e-17) Length = 452 Score = 27.9 bits (59), Expect = 7.4 Identities = 17/59 (28%), Positives = 24/59 (40%) Frame = +2 Query: 41 RQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKDHVHRLKEQVLEHAN 217 +Q N+ + R ER +K D K + + + L DH L QV EH N Sbjct: 311 KQTNKRTNEQTNERTNERTNKQRDNKNEKKINKTTTSVIYLSLCDHERHLLVQVQEHRN 369 >SB_11738| Best HMM Match : SH3_2 (HMM E-Value=3.7e-32) Length = 2436 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/40 (32%), Positives = 26/40 (65%), Gaps = 3/40 (7%) Frame = +2 Query: 107 EDKVKILKGENAELAQMVVKLKDHVHRLKEQ---VLEHAN 217 E+K++ LK N+EL + +L+D +L+++ +L+ AN Sbjct: 334 EEKIRKLKKRNSELVSIARQLEDKAKKLQDEKNAILKQAN 373 >SB_31791| Best HMM Match : PIG-U (HMM E-Value=0.15) Length = 1366 Score = 27.9 bits (59), Expect = 7.4 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -2 Query: 283 SLECGGEATASRSE-VRFDVAAAVRVLQHLLLQPVNVVFQ 167 S+ G A SE ++ +V RVL +L+LQ NV+FQ Sbjct: 118 SITLSGVVFADNSECLKVEVVGIPRVLSNLMLQLKNVLFQ 157 >SB_54664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 27.5 bits (58), Expect = 9.7 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +2 Query: 80 RKLERISKLEDKVKILKGENAELAQMVVKLKDHVHRLK 193 R+LER+ + E K++ ++ E + VKLKD + LK Sbjct: 42 RELERLRESEQKIRQVQEEIPKCITESVKLKDLLEELK 79 >SB_53556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1524 Score = 27.5 bits (58), Expect = 9.7 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +2 Query: 89 ERISKLEDKVKILKGENAELAQMVVKLKDHVHRLKEQV 202 E+ ++L+ K L ENAELA+ L+ + RLK+++ Sbjct: 287 EQFARLQAKYDELVAENAELAENCDLLEKNEARLKKEI 324 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 27.5 bits (58), Expect = 9.7 Identities = 16/55 (29%), Positives = 26/55 (47%) Frame = +2 Query: 38 KRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKDHVHRLKEQV 202 K ++ K R E++ +L KV L+GE E + KLK + +EQ+ Sbjct: 1322 KALEKEISNLKDRNNNGEKVQELLHKVTYLEGELKERSVETEKLKQTLQEREEQI 1376 >SB_54574| Best HMM Match : WD40 (HMM E-Value=0) Length = 1050 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -3 Query: 201 TCSFSL*TWSFNFTTICASSAFSP 130 +CS TW +N ++ C S AFSP Sbjct: 705 SCSSGEQTWVYNSSSTCLSLAFSP 728 >SB_42708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 27.5 bits (58), Expect = 9.7 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Frame = +2 Query: 11 SQERIKLERK--RQRNRVAASKCRRRKLERISKLEDKVKILKGENAEL 148 S R + E K + R +VAA + R R ER+S++++ L+ EN EL Sbjct: 107 SSRRTQNESKSCKARQKVAAQEARERNEERLSEIDE----LERENREL 150 >SB_32768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1393 Score = 27.5 bits (58), Expect = 9.7 Identities = 17/64 (26%), Positives = 36/64 (56%) Frame = +2 Query: 8 DSQERIKLERKRQRNRVAASKCRRRKLERISKLEDKVKILKGENAELAQMVVKLKDHVHR 187 + +ER + +R+R+ R+A K RR ER+ + E++ ++ E + + ++ V R Sbjct: 1040 EERERREADRRREEERIAEQK-RRDDEERLRREEEERRL----EEERRREEERKREEVRR 1094 Query: 188 LKEQ 199 L+E+ Sbjct: 1095 LEEE 1098 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,362,948 Number of Sequences: 59808 Number of extensions: 382250 Number of successful extensions: 1556 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 1363 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1535 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1608851125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -