BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_A12 (332 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g24180.1 68417.m03470 pathogenesis-related thaumatin family p... 31 0.25 At3g62160.1 68416.m06984 transferase family protein low similari... 29 0.77 At5g49850.1 68418.m06173 jacalin lectin family protein similar t... 28 1.8 At5g01770.1 68418.m00096 transducin family protein / WD-40 repea... 26 5.5 At3g49220.1 68416.m05379 pectinesterase family protein contains ... 26 7.2 At2g20000.1 68415.m02338 cell division cycle family protein / CD... 26 7.2 At1g36310.1 68414.m04513 expressed protein 26 7.2 At5g41040.2 68418.m04989 transferase family protein similar to h... 25 9.5 At5g41040.1 68418.m04988 transferase family protein similar to h... 25 9.5 At4g12230.1 68417.m01940 esterase/lipase/thioesterase family pro... 25 9.5 At1g28340.1 68414.m03481 leucine-rich repeat family protein cont... 25 9.5 >At4g24180.1 68417.m03470 pathogenesis-related thaumatin family protein similar to SP|P28493 Pathogenesis-related protein 5 precursor (PR-5) {Arabidopsis thaliana}; contains Pfam profile PF00314: Thaumatin family Length = 255 Score = 30.7 bits (66), Expect = 0.25 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -1 Query: 233 GIVTSLNRRVPREFRYGTQAVCKT 162 G VT LN++ P E R+G+ + CK+ Sbjct: 165 GCVTDLNQKCPTELRFGSGSACKS 188 >At3g62160.1 68416.m06984 transferase family protein low similarity to Taxus cuspidata transferases: 10-deacetylbaccatin III-10-O-acetyl transferase GI:6746554, taxadienol acetyl transferase GI:6978038, 2-debenzoyl-7,13-diacetylbaccatin III-2-O-benzoyl transferase GI:11559716; contains Pfam profile PF02458 transferase family Length = 428 Score = 29.1 bits (62), Expect = 0.77 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -1 Query: 230 IVTSLNRRVPREFRYGTQAVCKTLEVITCC 141 I + L R REFR T +C EVI C Sbjct: 224 IPSDLIERFKREFRASTGEICSAFEVIAAC 253 >At5g49850.1 68418.m06173 jacalin lectin family protein similar to myrosinase-binding protein homolog [Arabidopsis thaliana] GI:2997767; contains Pfam profile PF01419 jacalin-like lectin domain Length = 596 Score = 27.9 bits (59), Expect = 1.8 Identities = 12/59 (20%), Positives = 25/59 (42%) Frame = +3 Query: 96 KHRRGEIYYNFYQQLTTRYYFERLTNGLGSIPEFSWYSPIKTGYYPLMTSYYFPFAQRP 272 K +G F ++ + F + G + WY+P+ GY + ++++P P Sbjct: 386 KTSKGRTSRTFGERTSDSVEFVIESKGCAVVGFHGWYAPLGAGYITALGAHFYPMPLPP 444 >At5g01770.1 68418.m00096 transducin family protein / WD-40 repeat family protein similar to WD-repeat protein mip1 (SP:P87141) [Schizosaccharomyces pombe] Length = 1354 Score = 26.2 bits (55), Expect = 5.5 Identities = 15/54 (27%), Positives = 23/54 (42%) Frame = +3 Query: 171 NGLGSIPEFSWYSPIKTGYYPLMTSYYFPFAQRPDNYNLHSVKNYEAIRFLDIF 332 +GL +IP +W + +TG + + P D V NYE L+ F Sbjct: 1004 SGLSNIPIANWDTKFETGTKTALLHPFSPIVVAADENERIRVWNYEEATLLNGF 1057 >At3g49220.1 68416.m05379 pectinesterase family protein contains Pfam profile: PF01095 pectinesterase Length = 598 Score = 25.8 bits (54), Expect = 7.2 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +3 Query: 87 GNLKHRRGEIYYNFYQQLTTRYYFERLTNGLGS 185 G H RG + +N L T YY E L +G GS Sbjct: 518 GGHVHTRGWLEWNTTFALDTLYYGEYLNSGPGS 550 >At2g20000.1 68415.m02338 cell division cycle family protein / CDC family protein low similarity to SP|P30260|CC27_HUMAN Protein CDC27Hs (Cell division cycle protein 27 homolog) Homo sapiens; contains Pfam profile PF00515: TPR Domain Length = 744 Score = 25.8 bits (54), Expect = 7.2 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = +3 Query: 129 YQQLTTRYYFERLTNGLGSIPEFSWYSPIKTGYYPLMTSYY 251 YQ+ ERL L + E Y+P ++ Y LM Y Sbjct: 658 YQKANILVCLERLDEALEVLEELKEYAPSESSVYALMGRIY 698 >At1g36310.1 68414.m04513 expressed protein Length = 404 Score = 25.8 bits (54), Expect = 7.2 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +3 Query: 102 RRGEIYYNFYQQLTTRYYFERLTNGLGS 185 R+G + YN Y + + ERL +G+G+ Sbjct: 352 RKGAVVYNRYYHVFSEGELERLASGVGN 379 >At5g41040.2 68418.m04989 transferase family protein similar to hypersensitivity-related gene product HSR201 - Nicotiana tabacum, EMBL:X95343; contains Pfam transferase family domain PF00248 Length = 441 Score = 25.4 bits (53), Expect = 9.5 Identities = 10/20 (50%), Positives = 17/20 (85%) Frame = +2 Query: 131 PTINNTLLLRASYKRLGFHT 190 P++++TLL+ ++ RLGFHT Sbjct: 368 PSLSSTLLI-TTWSRLGFHT 386 >At5g41040.1 68418.m04988 transferase family protein similar to hypersensitivity-related gene product HSR201 - Nicotiana tabacum, EMBL:X95343; contains Pfam transferase family domain PF00248 Length = 457 Score = 25.4 bits (53), Expect = 9.5 Identities = 10/20 (50%), Positives = 17/20 (85%) Frame = +2 Query: 131 PTINNTLLLRASYKRLGFHT 190 P++++TLL+ ++ RLGFHT Sbjct: 384 PSLSSTLLI-TTWSRLGFHT 402 >At4g12230.1 68417.m01940 esterase/lipase/thioesterase family protein low similarity to 2-hydroxy-6-ketonona-2,4-dienedoic acid hydrolase; OhpC [Rhodococcus sp.] GI:8926386; contains Interpro entry IPR000379 Length = 392 Score = 25.4 bits (53), Expect = 9.5 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 252 FPFAQRPDNYNLH 290 FPF RPD NLH Sbjct: 252 FPFLSRPDEVNLH 264 >At1g28340.1 68414.m03481 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains some similarity to receptor-like protein kinases Length = 626 Score = 25.4 bits (53), Expect = 9.5 Identities = 13/31 (41%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Frame = +3 Query: 231 PLMTSYYFPFAQRPDN-YNLHSV-KNYEAIR 317 PL T YFP ++ P+N YN+ V K + ++R Sbjct: 71 PLKTLRYFPISEGPNNCYNIVRVPKGHYSVR 101 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,663,530 Number of Sequences: 28952 Number of extensions: 122445 Number of successful extensions: 348 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 336 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 347 length of database: 12,070,560 effective HSP length: 71 effective length of database: 10,014,968 effective search space used: 390583752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -