BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_A09 (650 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 23 3.4 S76958-1|AAB33933.1| 90|Apis mellifera olfactory receptor prot... 22 4.5 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 22 5.9 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 22.6 bits (46), Expect = 3.4 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +1 Query: 409 KLLHISPRLWTIHYWSTTCCWRRSFARRNLYGISSWR*QVCL 534 K L + L T+ W T C F + + +S W QV L Sbjct: 314 KYLLFTMILVTLSIWITVCVLNVHFRSPSTHNMSPWVRQVFL 355 >S76958-1|AAB33933.1| 90|Apis mellifera olfactory receptor protein. Length = 90 Score = 22.2 bits (45), Expect = 4.5 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = -1 Query: 647 FCHLAIQVPIV 615 FCH IQ+P++ Sbjct: 13 FCHSIIQIPVI 23 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 21.8 bits (44), Expect = 5.9 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -1 Query: 359 LSTNQHV*LDLHQLLNPLH 303 +S NQH+ ++L Q + LH Sbjct: 552 ISKNQHLFVELDQFIQNLH 570 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,640 Number of Sequences: 438 Number of extensions: 3300 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -