BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_A02 (708 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2G11.09 |||DUF221 family protein|Schizosaccharomyces pombe|c... 27 2.0 SPAC14C4.13 |rad17||RFC related checkpoint protein Rad17|Schizos... 27 2.0 SPBC557.04 |ppk29||Ark1/Prk1 family protein kinase Ppk29|Schizos... 27 3.5 SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr ... 26 4.6 SPBC405.03c |||membrane transporter |Schizosaccharomyces pombe|c... 26 4.6 SPBC17A3.05c |||DNAJ/DUF1977 DNAJB12 homolog|Schizosaccharomyces... 26 6.1 SPAC144.15c |cog1||Golgi transport complex subunit Cog1 |Schizos... 25 8.0 >SPAC2G11.09 |||DUF221 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 796 Score = 27.5 bits (58), Expect = 2.0 Identities = 10/37 (27%), Positives = 22/37 (59%) Frame = +1 Query: 532 LMSYTKLRMSLITASFWICTILFISSIFTLVSASIFA 642 +M T + + + ++W+ T++F FT++SA F+ Sbjct: 702 IMQLTMMGLMSLRKAYWLSTVIFPLLCFTVISAYNFS 738 >SPAC14C4.13 |rad17||RFC related checkpoint protein Rad17|Schizosaccharomyces pombe|chr 1|||Manual Length = 606 Score = 27.5 bits (58), Expect = 2.0 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +1 Query: 202 YLMQKPSEL*IHKLYLTGLTQWQLFFYLSFQNFTLC 309 Y+ QK ++L +HK ++ + QW L L + +C Sbjct: 76 YIPQKAADLAVHKSKISAIKQWMLTDSLESRLLLIC 111 >SPBC557.04 |ppk29||Ark1/Prk1 family protein kinase Ppk29|Schizosaccharomyces pombe|chr 2|||Manual Length = 872 Score = 26.6 bits (56), Expect = 3.5 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +3 Query: 603 LINLHSGLGVDFRSD 647 +INL+SGLG+D +SD Sbjct: 217 MINLYSGLGIDEKSD 231 >SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr 1|||Manual Length = 1854 Score = 26.2 bits (55), Expect = 4.6 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +1 Query: 256 LTQWQLFF--YLSFQNFTLCVINKYTLLQSVMKIP 354 L ++LFF Y + + L V+N TLL S+ K P Sbjct: 571 LPDYRLFFRRYTNLVDIVLAVLNLVTLLPSIRKNP 605 >SPBC405.03c |||membrane transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 341 Score = 26.2 bits (55), Expect = 4.6 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -2 Query: 257 NPVRYNLCIHSSLGFCIKY*SARYHSN 177 +P+ + + SLGFCI + +A Y SN Sbjct: 95 SPLGFRQTAYLSLGFCIIWFAANYFSN 121 >SPBC17A3.05c |||DNAJ/DUF1977 DNAJB12 homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 403 Score = 25.8 bits (54), Expect = 6.1 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +2 Query: 158 ADLQIFNWNDTELINI*CKNQANYEYT 238 A L F+W+D+ +N Q NY+YT Sbjct: 278 AFLSNFSWSDSTSVNTRYSFQQNYKYT 304 >SPAC144.15c |cog1||Golgi transport complex subunit Cog1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 701 Score = 25.4 bits (53), Expect = 8.0 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +3 Query: 489 MYHLSYAIVDVEFRLDVIHQVEDVFDNSL-FLDLHHFVHLINLH 617 M H+ D+EF I+ + D +N +D HF+ LI+LH Sbjct: 620 MDHMKQNTFDMEF----INYLSDFTNNPREVIDYQHFIELIDLH 659 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,667,686 Number of Sequences: 5004 Number of extensions: 56566 Number of successful extensions: 145 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 141 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 145 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 329179816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -