BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_A02 (708 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g21310.1 68416.m02692 expressed protein contains Pfam profile... 30 1.3 At1g67140.1 68414.m07638 expressed protein 29 4.0 At1g51770.1 68414.m05834 hypothetical protein contains Pfam prof... 29 4.0 At5g51050.1 68418.m06328 mitochondrial substrate carrier family ... 28 5.3 At3g44920.1 68416.m04839 cation/hydrogen exchanger, putative (CH... 28 5.3 At2g34710.1 68415.m04263 homeobox-leucine zipper transcription f... 28 5.3 At4g10620.1 68417.m01736 expressed protein 28 7.0 At4g02405.1 68417.m00325 expressed protein 27 9.2 >At3g21310.1 68416.m02692 expressed protein contains Pfam profile PF03267: Arabidopsis protein of unknown function, DUF266 Length = 383 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/35 (40%), Positives = 23/35 (65%) Frame = -3 Query: 262 ALIPLDITCVFIVRLVFALNINQLGIIPIKYLKIR 158 AL+P+ + VF++ V L I+ + + IKYLKI+ Sbjct: 25 ALLPMRVLQVFLLFFVLVLGISVISMHMIKYLKIQ 59 >At1g67140.1 68414.m07638 expressed protein Length = 2158 Score = 28.7 bits (61), Expect = 4.0 Identities = 11/43 (25%), Positives = 25/43 (58%) Frame = +3 Query: 534 DVIHQVEDVFDNSLFLDLHHFVHLINLHSGLGVDFRSDTFPCC 662 +V H+ ++ FD+++ L HF+ L+ + + L + ++ P C Sbjct: 369 EVPHEFKEFFDDTVGAALSHFLDLVRVEAALTLRALAEVDPTC 411 >At1g51770.1 68414.m05834 hypothetical protein contains Pfam profile PF03267: Arabidopsis protein of unknown function, DUF266 Length = 399 Score = 28.7 bits (61), Expect = 4.0 Identities = 14/35 (40%), Positives = 23/35 (65%) Frame = -3 Query: 262 ALIPLDITCVFIVRLVFALNINQLGIIPIKYLKIR 158 AL+PL + + ++ LV L I+ + I IK+LKI+ Sbjct: 23 ALLPLRLLQILLLFLVLTLGISVVSIHMIKFLKIQ 57 >At5g51050.1 68418.m06328 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 487 Score = 28.3 bits (60), Expect = 5.3 Identities = 14/51 (27%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = -2 Query: 689 SKSLKPSTWATREGVAAKIDAETRVKIDEMNKMVQIQK-EAVIKDILNLVY 540 SK +K S + G+A +D + ++QIQK +A I++ + L++ Sbjct: 203 SKHIKRSNYFIAGGIAGAASRTATAPLDRLKVLLQIQKTDARIREAIKLIW 253 >At3g44920.1 68416.m04839 cation/hydrogen exchanger, putative (CHX11) monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 671 Score = 28.3 bits (60), Expect = 5.3 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +3 Query: 69 Y*HTSNNIQFKDYIYSVLFINIYFFTFVP 155 Y H S+ I ++D + ++F I FF F P Sbjct: 118 YIHVSHAIAYRDLVAVIIFFLIVFFVFKP 146 >At2g34710.1 68415.m04263 homeobox-leucine zipper transcription factor (HB-14) identical to homeodomain transcription factor (ATHB-14)GP:3132474 GB:Y11122 [Arabidopsis thaliana]; Length = 852 Score = 28.3 bits (60), Expect = 5.3 Identities = 15/45 (33%), Positives = 28/45 (62%), Gaps = 3/45 (6%) Frame = -2 Query: 644 AAKIDAETRVKIDEMNKMVQIQKEAVIKDILNLVYD---IKPELH 519 AA++ R K++ MNK++ + + + K + NLVY+ +K +LH Sbjct: 87 AARLQTVNR-KLNAMNKLLMEENDRLQKQVSNLVYENGHMKHQLH 130 >At4g10620.1 68417.m01736 expressed protein Length = 597 Score = 27.9 bits (59), Expect = 7.0 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -2 Query: 689 SKSLKPSTWATREGVAAKIDAETRVKIDE 603 SK LKP T+ +EG I R+ IDE Sbjct: 396 SKELKPRTYRIKEGYTVHIGGLMRLDIDE 424 >At4g02405.1 68417.m00325 expressed protein Length = 333 Score = 27.5 bits (58), Expect = 9.2 Identities = 14/56 (25%), Positives = 27/56 (48%) Frame = +3 Query: 171 YLIGMIPS*LIFNAKTKRTMNTQVISNGINAMAVIFLSVISKLYVMCYQ*IHFITV 338 YLIG +P+ + + + M +SNG V + + + L V+ + ++ TV Sbjct: 242 YLIGELPTNITLQSDLSKWMEKLFMSNGFRVKIVSYEEIAASLGVVLHSPVNHDTV 297 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,248,515 Number of Sequences: 28952 Number of extensions: 267230 Number of successful extensions: 603 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 594 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 603 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1526202912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -