BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_A01 (522 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 26 0.23 AF260822-1|AAG02020.1| 138|Tribolium castaneum alpha-esterase l... 22 2.9 AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory recept... 21 5.0 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 21 6.6 AF146649-1|AAD38009.1| 96|Tribolium castaneum ultrathorax prot... 21 6.6 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 25.8 bits (54), Expect = 0.23 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -3 Query: 193 NKTTLVLAIVRRLMNSVFDTYKLNRLYN 110 NKT + L I NSVF+ KL LY+ Sbjct: 317 NKTEIFLNITGDKTNSVFEHVKLGSLYH 344 >AF260822-1|AAG02020.1| 138|Tribolium castaneum alpha-esterase like protein E3 protein. Length = 138 Score = 22.2 bits (45), Expect = 2.9 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -2 Query: 509 YFIFSE*TTNIYAKKNYTYKNGTLVLINIKSRSEISELCIREYFL 375 YFIF +IY + +N LV +N + + LC+ + L Sbjct: 83 YFIFGSGNDDIYGPEFLLSENLVLVTVNYR-LGMLGFLCLEDLAL 126 >AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory receptor candidate 31 protein. Length = 250 Score = 21.4 bits (43), Expect = 5.0 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +2 Query: 380 NIHEYKVQIFRSAILY*SKLKSHFYMYNFFLRI 478 N++ +Q+F S + LK+ +Y+ +F L I Sbjct: 173 NLYFIIIQLFGSMKIVKGTLKTAYYLISFALLI 205 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 21.0 bits (42), Expect = 6.6 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -1 Query: 303 NGHRRRDKKIM*RHQRLKLWWYVHCEIY 220 NG RRR ++ R+Q L+L H Y Sbjct: 220 NGLRRRGRQTYTRYQTLELEKEFHTNHY 247 >AF146649-1|AAD38009.1| 96|Tribolium castaneum ultrathorax protein. Length = 96 Score = 21.0 bits (42), Expect = 6.6 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -1 Query: 303 NGHRRRDKKIM*RHQRLKLWWYVHCEIY 220 NG RRR ++ R+Q L+L H Y Sbjct: 2 NGLRRRGRQTYTRYQTLELEKEFHTNHY 29 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,519 Number of Sequences: 336 Number of extensions: 2369 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -