BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_A01 (522 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 25 0.62 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 24 0.82 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 1.9 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 22 4.4 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 24.6 bits (51), Expect = 0.62 Identities = 17/57 (29%), Positives = 25/57 (43%) Frame = +3 Query: 84 SLAADERHRLYNLFNLYVSKTLFIKRRTIAKTKVVLFQSGPEPSHHRFHNGHTTIIS 254 S+ + R LY F+L +S F R T + K + +P H + TIIS Sbjct: 251 SINKEARSNLYLPFHLTLSFRDFRDRTTEQQHKAMFLVVTAQPVHSAYKAPEETIIS 307 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 24.2 bits (50), Expect = 0.82 Identities = 13/29 (44%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = +3 Query: 126 NLY-VSKTLFIKRRTIAKTKVVLFQSGPE 209 +LY +K + IK IAK K++L GPE Sbjct: 571 SLYDTTKPIDIKYSKIAKKKMMLMNMGPE 599 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 1.9 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 224 ISQWTYHHNFN 256 +S W YHHN N Sbjct: 1674 MSTWGYHHNVN 1684 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 21.8 bits (44), Expect = 4.4 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +3 Query: 198 SGPEPSHHRFHNGHTTI 248 S P P HH +GH+ I Sbjct: 410 STPGPHHHTMGHGHSHI 426 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,596 Number of Sequences: 438 Number of extensions: 2766 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -