BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_P23 (542 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1778.02 |rap1||telomere binding protein Rap1|Schizosaccharom... 27 1.4 SPBC56F2.09c |arg5||arginine specific carbamoyl-phosphate syntha... 25 9.5 >SPBC1778.02 |rap1||telomere binding protein Rap1|Schizosaccharomyces pombe|chr 2|||Manual Length = 693 Score = 27.5 bits (58), Expect = 1.4 Identities = 18/70 (25%), Positives = 34/70 (48%) Frame = +3 Query: 300 HVTCNQLLTDDISVAATCAKKIYKRHKFDAWYGWKNHCQHGLPDISDC*EKALNFIKQLL 479 HV N + V A+K Y +H ++W + + LP +SD E N+ ++++ Sbjct: 136 HVHKNDINRFGTKVYEELARK-YPQHSLESWRQHYKYMKKRLPPVSDSDES--NYCQRII 192 Query: 480 MKFTSSSCNF 509 +K SS ++ Sbjct: 193 VKPYSSQKDY 202 >SPBC56F2.09c |arg5||arginine specific carbamoyl-phosphate synthase Arg5 |Schizosaccharomyces pombe|chr 2|||Manual Length = 415 Score = 24.6 bits (51), Expect = 9.5 Identities = 7/21 (33%), Positives = 14/21 (66%) Frame = -1 Query: 65 ECQKGEQYNVLRHYVSKRVSC 3 +C+K ++ +LRH+ S + C Sbjct: 108 DCKKRDENGLLRHFESPHIQC 128 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,162,871 Number of Sequences: 5004 Number of extensions: 41785 Number of successful extensions: 101 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 99 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 101 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 223909422 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -