BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_P21 (586 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z28339-1|CAA82193.1| 326|Homo sapiens delta 4-3-oxosteroid 5 be... 42 0.002 BC130627-1|AAI30628.1| 326|Homo sapiens aldo-keto reductase fam... 42 0.002 BC130625-1|AAI30626.1| 326|Homo sapiens aldo-keto reductase fam... 42 0.002 AF283659-1|AAG39381.1| 326|Homo sapiens 5-beta steroid reductas... 42 0.002 AL391427-2|CAI14727.1| 302|Homo sapiens aldo-keto reductase fam... 38 0.020 AL355303-1|CAI14201.1| 302|Homo sapiens aldo-keto reductase fam... 38 0.020 S68287-1|AAD14010.1| 323|Homo sapiens chlordecone reductase pro... 35 0.24 M33375-1|AAA35658.1| 308|Homo sapiens protein ( Human chlordeco... 35 0.24 D26125-1|BAA05122.1| 321|Homo sapiens 3 alpha-hydroxysteroid/di... 35 0.24 BC020744-1|AAH20744.1| 323|Homo sapiens aldo-keto reductase fam... 35 0.24 AL355303-2|CAI14202.1| 323|Homo sapiens aldo-keto reductase fam... 35 0.24 AB032163-1|BAA92893.1| 323|Homo sapiens dihydrodiol dehydrogena... 35 0.24 AB031085-1|BAA92885.1| 323|Homo sapiens dihydrodiol dehydrogena... 35 0.24 AB045829-1|BAA99542.1| 323|Homo sapiens 3alpha-hydroxysteroid d... 34 0.32 U05861-1|AAA18115.1| 323|Homo sapiens hepatic dihydrodiol dehyd... 32 1.7 U05684-1|AAA16227.1| 323|Homo sapiens dihydrodiol dehydrogenase... 32 1.7 U05598-1|AAA20937.1| 323|Homo sapiens dihydrodiol dehydrogenase... 32 1.7 M86609-1|AAB02880.1| 323|Homo sapiens dihydrodiol dehydrogenase... 32 1.7 D26124-1|BAA05121.1| 306|Homo sapiens dihydrodiol dehydrogenase... 32 1.7 BT007197-1|AAP35861.1| 323|Homo sapiens aldo-keto reductase fam... 32 1.7 BT006653-1|AAP35299.1| 323|Homo sapiens aldo-keto reductase fam... 32 1.7 BC063574-1|AAH63574.1| 323|Homo sapiens aldo-keto reductase fam... 32 1.7 BC040210-1|AAH40210.1| 323|Homo sapiens aldo-keto reductase fam... 32 1.7 BC020216-1|AAH20216.1| 323|Homo sapiens aldo-keto reductase fam... 32 1.7 BC015490-1|AAH15490.1| 323|Homo sapiens aldo-keto reductase fam... 32 1.7 BC007024-1|AAH07024.1| 323|Homo sapiens aldo-keto reductase fam... 32 1.7 AL713867-2|CAI16409.1| 323|Homo sapiens aldo-keto reductase fam... 32 1.7 AL713867-1|CAI16408.1| 323|Homo sapiens aldo-keto reductase fam... 32 1.7 AL391427-1|CAI14726.1| 323|Homo sapiens aldo-keto reductase fam... 32 1.7 AB032153-1|BAA92891.1| 323|Homo sapiens bile acid-binding prote... 32 1.7 AB032150-1|BAA92886.1| 323|Homo sapiens 20 alph-hydroxysteroid ... 32 1.7 AB031084-1|BAA92884.1| 323|Homo sapiens bile acid-binding prote... 32 1.7 AB031083-1|BAA92883.1| 323|Homo sapiens 20 alpha-hydroxysteroid... 32 1.7 AB021654-1|BAA36169.1| 323|Homo sapiens DD2/bile acid-binding p... 32 1.7 U37100-1|AAC17469.1| 316|Homo sapiens aldose reductase-like pep... 31 2.3 CR541801-1|CAG46600.1| 316|Homo sapiens AKR1B10 protein. 31 2.3 BT006794-1|AAP35440.1| 316|Homo sapiens aldo-keto reductase fam... 31 2.3 BC008837-1|AAH08837.1| 316|Homo sapiens aldo-keto reductase fam... 31 2.3 AF052577-1|AAC36465.1| 316|Homo sapiens aldo-keto reductase pro... 31 2.3 AF044961-1|AAC15671.1| 85|Homo sapiens aldose reductase-relate... 31 2.3 J04794-1|AAA51711.1| 325|Homo sapiens ALDR1 protein. 31 3.0 CR457010-1|CAG33291.1| 325|Homo sapiens AKR1A1 protein. 31 3.0 BT007003-1|AAP35649.1| 325|Homo sapiens aldo-keto reductase fam... 31 3.0 BC005394-1|AAH05394.1| 325|Homo sapiens aldo-keto reductase fam... 31 3.0 BC000670-1|AAH00670.1| 325|Homo sapiens aldo-keto reductase fam... 31 3.0 AL355480-3|CAI22459.1| 325|Homo sapiens aldo-keto reductase fam... 31 3.0 AF112485-1|AAF01260.1| 325|Homo sapiens aldehyde reductase prot... 31 3.0 AF036683-1|AAB92369.1| 325|Homo sapiens aldehyde reductase prot... 31 3.0 AF524864-1|AAO13380.1| 316|Homo sapiens aldo-ketoreductase prot... 31 4.0 AB040822-1|BAC54567.1| 222|Homo sapiens aldo-keto reductase rel... 31 4.0 AB040821-1|BAC54566.1| 263|Homo sapiens aldo-keto reductase rel... 31 4.0 AF263242-1|AAK58523.1| 320|Homo sapiens aldo-keto reductase loo... 30 5.2 X15414-1|CAA33460.1| 316|Homo sapiens protein ( Human mRNA for ... 30 6.9 M59783-1|AAA51712.1| 316|Homo sapiens aldose reductase protein. 30 6.9 M34720-1|AAA35560.1| 316|Homo sapiens protein ( Human aldose re... 30 6.9 J05474-1|AAA51715.1| 316|Homo sapiens aldose reductase protein. 30 6.9 J05017-1|AAA51714.1| 316|Homo sapiens ALDR1 protein. 30 6.9 J04795-1|AAA51713.1| 316|Homo sapiens ALDR1 protein. 30 6.9 CR542203-1|CAG47000.1| 316|Homo sapiens AKR1B1 protein. 30 6.9 CR450351-1|CAG29347.1| 316|Homo sapiens AKR1B1 protein. 30 6.9 BT019859-1|AAV38662.1| 316|Homo sapiens aldo-keto reductase fam... 30 6.9 BC010391-1|AAH10391.1| 316|Homo sapiens aldo-keto reductase fam... 30 6.9 BC005387-1|AAH05387.1| 316|Homo sapiens aldo-keto reductase fam... 30 6.9 BC000260-1|AAH00260.1| 316|Homo sapiens aldo-keto reductase fam... 30 6.9 AF328729-1|AAN09721.1| 316|Homo sapiens CTCL tumor antigen HD-C... 30 6.9 AF032455-1|AAB88851.1| 316|Homo sapiens aldose reductase protein. 30 6.9 S68288-1|AAD14011.1| 323|Homo sapiens chlordecone reductase hom... 29 9.1 L43839-1|AAB41916.1| 323|Homo sapiens 3-alpha-hydroxysteroid de... 29 9.1 D17793-1|BAA04619.2| 325|Homo sapiens KIAA0119 protein. 29 9.1 DQ269985-1|ABB76132.1| 323|Homo sapiens type II 3a-hydroxystero... 29 9.1 BT007286-1|AAP35950.1| 323|Homo sapiens aldo-keto reductase fam... 29 9.1 BC019230-1|AAH19230.1| 323|Homo sapiens aldo-keto reductase fam... 29 9.1 BC001479-1|AAH01479.1| 323|Homo sapiens aldo-keto reductase fam... 29 9.1 AL391427-4|CAI14729.1| 323|Homo sapiens aldo-keto reductase fam... 29 9.1 AF149416-1|AAF07272.2| 323|Homo sapiens 3-alpha hydroxysteroid ... 29 9.1 AB032157-1|BAA92892.1| 323|Homo sapiens prostaglandin F synthas... 29 9.1 AB018580-1|BAA88488.1| 323|Homo sapiens hluPGFS protein. 29 9.1 >Z28339-1|CAA82193.1| 326|Homo sapiens delta 4-3-oxosteroid 5 beta-reductase protein. Length = 326 Score = 41.5 bits (93), Expect = 0.002 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 K+N I DF+LT EE+ + N N R W HP +PF Sbjct: 281 KENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPF 322 >BC130627-1|AAI30628.1| 326|Homo sapiens aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase protein. Length = 326 Score = 41.5 bits (93), Expect = 0.002 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 K+N I DF+LT EE+ + N N R W HP +PF Sbjct: 281 KENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPF 322 >BC130625-1|AAI30626.1| 326|Homo sapiens aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase protein. Length = 326 Score = 41.5 bits (93), Expect = 0.002 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 K+N I DF+LT EE+ + N N R W HP +PF Sbjct: 281 KENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPF 322 >AF283659-1|AAG39381.1| 326|Homo sapiens 5-beta steroid reductase protein. Length = 326 Score = 41.5 bits (93), Expect = 0.002 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 K+N I DF+LT EE+ + N N R W HP +PF Sbjct: 281 KENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPF 322 >AL391427-2|CAI14727.1| 302|Homo sapiens aldo-keto reductase family 1, member C-like 1 protein. Length = 302 Score = 38.3 bits (85), Expect = 0.020 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPFEKK 137 K+N I DF LT E++ + N N R A HPYFPF ++ Sbjct: 260 KENFQIFDFELTPEDMKAIDGLNRNLRYDNAAN---HPYFPFSEE 301 >AL355303-1|CAI14201.1| 302|Homo sapiens aldo-keto reductase family 1, member C-like 1 protein. Length = 302 Score = 38.3 bits (85), Expect = 0.020 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPFEKK 137 K+N I DF LT E++ + N N R A HPYFPF ++ Sbjct: 260 KENFQIFDFELTPEDMKAIDGLNRNLRYDNAAN---HPYFPFSEE 301 >S68287-1|AAD14010.1| 323|Homo sapiens chlordecone reductase protein. Length = 323 Score = 34.7 bits (76), Expect = 0.24 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 ++NI + +F LT E++ L N NYR HP +PF Sbjct: 278 RENIQVFEFQLTSEDMKVLDGLNRNYRYVVMDFLMDHPDYPF 319 >M33375-1|AAA35658.1| 308|Homo sapiens protein ( Human chlordecone reductase mRNA, complete cds. ). Length = 308 Score = 34.7 bits (76), Expect = 0.24 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 ++NI + +F LT E++ L N NYR HP +PF Sbjct: 263 RENIQVFEFQLTSEDMKVLDGLNRNYRYVVMDFLMDHPDYPF 304 >D26125-1|BAA05122.1| 321|Homo sapiens 3 alpha-hydroxysteroid/dihydrodiol dehydrogenase DD4 protein. Length = 321 Score = 34.7 bits (76), Expect = 0.24 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 ++NI + +F LT E++ L N NYR HP +PF Sbjct: 276 RENIQVFEFQLTSEDMKVLDGLNRNYRYVVMDFLMDHPDYPF 317 >BC020744-1|AAH20744.1| 323|Homo sapiens aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxy protein. Length = 323 Score = 34.7 bits (76), Expect = 0.24 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 ++NI + +F LT E++ L N NYR HP +PF Sbjct: 278 RENIQVFEFQLTSEDMKVLDGLNRNYRYVVMDFLMDHPDYPF 319 >AL355303-2|CAI14202.1| 323|Homo sapiens aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxy protein. Length = 323 Score = 34.7 bits (76), Expect = 0.24 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 ++NI + +F LT E++ L N NYR HP +PF Sbjct: 278 RENIQVFEFQLTSEDMKVLDGLNRNYRYVVMDFLMDHPDYPF 319 >AB032163-1|BAA92893.1| 323|Homo sapiens dihydrodiol dehydrogenase 4 protein. Length = 323 Score = 34.7 bits (76), Expect = 0.24 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 ++NI + +F LT E++ L N NYR HP +PF Sbjct: 278 RENIQVFEFQLTSEDMKVLDGLNRNYRYVVMDFLMDHPDYPF 319 >AB031085-1|BAA92885.1| 323|Homo sapiens dihydrodiol dehydrogenase 4 protein. Length = 323 Score = 34.7 bits (76), Expect = 0.24 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 ++NI + +F LT E++ L N NYR HP +PF Sbjct: 278 RENIQVFEFQLTSEDMKVLDGLNRNYRYVVMDFLMDHPDYPF 319 >AB045829-1|BAA99542.1| 323|Homo sapiens 3alpha-hydroxysteroid dehydrogenase variant protein. Length = 323 Score = 34.3 bits (75), Expect = 0.32 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 ++NI + +F LT E++ L N NYR HP +PF Sbjct: 278 RENIQVFEFQLTSEDMKVLDGLNRNYRYVVMDFVMDHPDYPF 319 >U05861-1|AAA18115.1| 323|Homo sapiens hepatic dihydrodiol dehydrogenase protein. Length = 323 Score = 31.9 bits (69), Expect = 1.7 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 +QN+ + +F LT EE+ + N N R T + P +PF Sbjct: 278 RQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF 319 >U05684-1|AAA16227.1| 323|Homo sapiens dihydrodiol dehydrogenase protein. Length = 323 Score = 31.9 bits (69), Expect = 1.7 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 +QN+ + +F LT EE+ + N N R T + P +PF Sbjct: 278 RQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF 319 >U05598-1|AAA20937.1| 323|Homo sapiens dihydrodiol dehydrogenase protein. Length = 323 Score = 31.9 bits (69), Expect = 1.7 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 +QN+ + +F LT EE+ + N N R T + P +PF Sbjct: 278 RQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF 319 >M86609-1|AAB02880.1| 323|Homo sapiens dihydrodiol dehydrogenase protein. Length = 323 Score = 31.9 bits (69), Expect = 1.7 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 +QN+ + +F LT EE+ + N N R T + P +PF Sbjct: 278 RQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF 319 >D26124-1|BAA05121.1| 306|Homo sapiens dihydrodiol dehydrogenase isoform DD1 protein. Length = 306 Score = 31.9 bits (69), Expect = 1.7 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 +QN+ + +F LT EE+ + N N R T + P +PF Sbjct: 261 RQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF 302 >BT007197-1|AAP35861.1| 323|Homo sapiens aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha protein. Length = 323 Score = 31.9 bits (69), Expect = 1.7 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 +QN+ + +F LT EE+ + N N R T + P +PF Sbjct: 278 RQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF 319 >BT006653-1|AAP35299.1| 323|Homo sapiens aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid protein. Length = 323 Score = 31.9 bits (69), Expect = 1.7 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 +QN+ + +F LT EE+ + N N R T + P +PF Sbjct: 278 RQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF 319 >BC063574-1|AAH63574.1| 323|Homo sapiens aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid protein. Length = 323 Score = 31.9 bits (69), Expect = 1.7 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 +QN+ + +F LT EE+ + N N R T + P +PF Sbjct: 278 RQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF 319 >BC040210-1|AAH40210.1| 323|Homo sapiens aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha protein. Length = 323 Score = 31.9 bits (69), Expect = 1.7 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 +QN+ + +F LT EE+ + N N R T + P +PF Sbjct: 278 RQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF 319 >BC020216-1|AAH20216.1| 323|Homo sapiens aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha protein. Length = 323 Score = 31.9 bits (69), Expect = 1.7 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 +QN+ + +F LT EE+ + N N R T + P +PF Sbjct: 278 RQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF 319 >BC015490-1|AAH15490.1| 323|Homo sapiens aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha protein. Length = 323 Score = 31.9 bits (69), Expect = 1.7 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 +QN+ + +F LT EE+ + N N R T + P +PF Sbjct: 278 RQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF 319 >BC007024-1|AAH07024.1| 323|Homo sapiens aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid protein. Length = 323 Score = 31.9 bits (69), Expect = 1.7 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 +QN+ + +F LT EE+ + N N R T + P +PF Sbjct: 278 RQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF 319 >AL713867-2|CAI16409.1| 323|Homo sapiens aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha protein. Length = 323 Score = 31.9 bits (69), Expect = 1.7 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 +QN+ + +F LT EE+ + N N R T + P +PF Sbjct: 278 RQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF 319 >AL713867-1|CAI16408.1| 323|Homo sapiens aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid protein. Length = 323 Score = 31.9 bits (69), Expect = 1.7 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 +QN+ + +F LT EE+ + N N R T + P +PF Sbjct: 278 RQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF 319 >AL391427-1|CAI14726.1| 323|Homo sapiens aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid protein. Length = 323 Score = 31.9 bits (69), Expect = 1.7 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 +QN+ + +F LT EE+ + N N R T + P +PF Sbjct: 278 RQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF 319 >AB032153-1|BAA92891.1| 323|Homo sapiens bile acid-binding protein protein. Length = 323 Score = 31.9 bits (69), Expect = 1.7 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 +QN+ + +F LT EE+ + N N R T + P +PF Sbjct: 278 RQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF 319 >AB032150-1|BAA92886.1| 323|Homo sapiens 20 alph-hydroxysteroid dehydrogenase protein. Length = 323 Score = 31.9 bits (69), Expect = 1.7 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 +QN+ + +F LT EE+ + N N R T + P +PF Sbjct: 278 RQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF 319 >AB031084-1|BAA92884.1| 323|Homo sapiens bile acid-binding protein protein. Length = 323 Score = 31.9 bits (69), Expect = 1.7 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 +QN+ + +F LT EE+ + N N R T + P +PF Sbjct: 278 RQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF 319 >AB031083-1|BAA92883.1| 323|Homo sapiens 20 alpha-hydroxysteroid dehydrogenase protein. Length = 323 Score = 31.9 bits (69), Expect = 1.7 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 +QN+ + +F LT EE+ + N N R T + P +PF Sbjct: 278 RQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF 319 >AB021654-1|BAA36169.1| 323|Homo sapiens DD2/bile acid-binding protein/AKR1C2/3alpha-hydroxysteroid dehydrogenase type 3 protein. Length = 323 Score = 31.9 bits (69), Expect = 1.7 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 +QN+ + +F LT EE+ + N N R T + P +PF Sbjct: 278 RQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPF 319 >U37100-1|AAC17469.1| 316|Homo sapiens aldose reductase-like peptide protein. Length = 316 Score = 31.5 bits (68), Expect = 2.3 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +3 Query: 6 QNIDIIDFNLTREEVAKLSQFNSNYR 83 +NI + DF L+ EE+A + FN N+R Sbjct: 272 ENIQVFDFKLSDEEMATILSFNRNWR 297 >CR541801-1|CAG46600.1| 316|Homo sapiens AKR1B10 protein. Length = 316 Score = 31.5 bits (68), Expect = 2.3 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +3 Query: 6 QNIDIIDFNLTREEVAKLSQFNSNYR 83 +NI + DF L+ EE+A + FN N+R Sbjct: 272 ENIQVFDFKLSDEEMATILSFNRNWR 297 >BT006794-1|AAP35440.1| 316|Homo sapiens aldo-keto reductase family 1, member B10 (aldose reductase) protein. Length = 316 Score = 31.5 bits (68), Expect = 2.3 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +3 Query: 6 QNIDIIDFNLTREEVAKLSQFNSNYR 83 +NI + DF L+ EE+A + FN N+R Sbjct: 272 ENIQVFDFKLSDEEMATILSFNRNWR 297 >BC008837-1|AAH08837.1| 316|Homo sapiens aldo-keto reductase family 1, member B10 (aldose reductase) protein. Length = 316 Score = 31.5 bits (68), Expect = 2.3 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +3 Query: 6 QNIDIIDFNLTREEVAKLSQFNSNYR 83 +NI + DF L+ EE+A + FN N+R Sbjct: 272 ENIQVFDFKLSDEEMATILSFNRNWR 297 >AF052577-1|AAC36465.1| 316|Homo sapiens aldo-keto reductase protein. Length = 316 Score = 31.5 bits (68), Expect = 2.3 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +3 Query: 6 QNIDIIDFNLTREEVAKLSQFNSNYR 83 +NI + DF L+ EE+A + FN N+R Sbjct: 272 ENIQVFDFKLSDEEMATILSFNRNWR 297 >AF044961-1|AAC15671.1| 85|Homo sapiens aldose reductase-related protein protein. Length = 85 Score = 31.5 bits (68), Expect = 2.3 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +3 Query: 6 QNIDIIDFNLTREEVAKLSQFNSNYR 83 +NI + DF L+ EE+A + FN N+R Sbjct: 41 ENIQVFDFKLSDEEMATILSFNRNWR 66 >J04794-1|AAA51711.1| 325|Homo sapiens ALDR1 protein. Length = 325 Score = 31.1 bits (67), Expect = 3.0 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 9/50 (18%) Frame = +3 Query: 6 QNIDIIDFNLTREEVAKLSQFNSNYRLRTP-----AKWYP----HPYFPF 128 QNI + DF + EE+ +L+ N N+R P K P HP +PF Sbjct: 272 QNIKVFDFTFSPEEMKQLNALNKNWRYIVPMLTVDGKRVPRDAGHPLYPF 321 >CR457010-1|CAG33291.1| 325|Homo sapiens AKR1A1 protein. Length = 325 Score = 31.1 bits (67), Expect = 3.0 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 9/50 (18%) Frame = +3 Query: 6 QNIDIIDFNLTREEVAKLSQFNSNYRLRTP-----AKWYP----HPYFPF 128 QNI + DF + EE+ +L+ N N+R P K P HP +PF Sbjct: 272 QNIKVFDFTFSPEEMKQLNALNKNWRYIVPMLTVDGKRVPRDAGHPLYPF 321 >BT007003-1|AAP35649.1| 325|Homo sapiens aldo-keto reductase family 1, member A1 (aldehyde reductase) protein. Length = 325 Score = 31.1 bits (67), Expect = 3.0 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 9/50 (18%) Frame = +3 Query: 6 QNIDIIDFNLTREEVAKLSQFNSNYRLRTP-----AKWYP----HPYFPF 128 QNI + DF + EE+ +L+ N N+R P K P HP +PF Sbjct: 272 QNIKVFDFTFSPEEMKQLNALNKNWRYIVPMLTVDGKRVPRDAGHPLYPF 321 >BC005394-1|AAH05394.1| 325|Homo sapiens aldo-keto reductase family 1, member A1 (aldehyde reductase) protein. Length = 325 Score = 31.1 bits (67), Expect = 3.0 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 9/50 (18%) Frame = +3 Query: 6 QNIDIIDFNLTREEVAKLSQFNSNYRLRTP-----AKWYP----HPYFPF 128 QNI + DF + EE+ +L+ N N+R P K P HP +PF Sbjct: 272 QNIKVFDFTFSPEEMKQLNALNKNWRYIVPMLTVDGKRVPRDAGHPLYPF 321 >BC000670-1|AAH00670.1| 325|Homo sapiens aldo-keto reductase family 1, member A1 (aldehyde reductase) protein. Length = 325 Score = 31.1 bits (67), Expect = 3.0 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 9/50 (18%) Frame = +3 Query: 6 QNIDIIDFNLTREEVAKLSQFNSNYRLRTP-----AKWYP----HPYFPF 128 QNI + DF + EE+ +L+ N N+R P K P HP +PF Sbjct: 272 QNIKVFDFTFSPEEMKQLNALNKNWRYIVPMLTVDGKRVPRDAGHPLYPF 321 >AL355480-3|CAI22459.1| 325|Homo sapiens aldo-keto reductase family 1, member A1 (aldehydetase, 1 protein. Length = 325 Score = 31.1 bits (67), Expect = 3.0 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 9/50 (18%) Frame = +3 Query: 6 QNIDIIDFNLTREEVAKLSQFNSNYRLRTP-----AKWYP----HPYFPF 128 QNI + DF + EE+ +L+ N N+R P K P HP +PF Sbjct: 272 QNIKVFDFTFSPEEMKQLNALNKNWRYIVPMLTVDGKRVPRDAGHPLYPF 321 >AF112485-1|AAF01260.1| 325|Homo sapiens aldehyde reductase protein. Length = 325 Score = 31.1 bits (67), Expect = 3.0 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 9/50 (18%) Frame = +3 Query: 6 QNIDIIDFNLTREEVAKLSQFNSNYRLRTP-----AKWYP----HPYFPF 128 QNI + DF + EE+ +L+ N N+R P K P HP +PF Sbjct: 272 QNIKVFDFTFSPEEMKQLNALNKNWRYIVPMLTVDGKRVPRDAGHPLYPF 321 >AF036683-1|AAB92369.1| 325|Homo sapiens aldehyde reductase protein. Length = 325 Score = 31.1 bits (67), Expect = 3.0 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 9/50 (18%) Frame = +3 Query: 6 QNIDIIDFNLTREEVAKLSQFNSNYRLRTP-----AKWYP----HPYFPF 128 QNI + DF + EE+ +L+ N N+R P K P HP +PF Sbjct: 272 QNIKVFDFTFSPEEMKQLNALNKNWRYIVPMLTVDGKRVPRDAGHPLYPF 321 >AF524864-1|AAO13380.1| 316|Homo sapiens aldo-ketoreductase protein. Length = 316 Score = 30.7 bits (66), Expect = 4.0 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +3 Query: 6 QNIDIIDFNLTREEVAKLSQFNSNYR 83 +NI + DF L+ EE+A + FN N+R Sbjct: 272 ENIQVFDFKLSDEEMAIILSFNRNWR 297 >AB040822-1|BAC54567.1| 222|Homo sapiens aldo-keto reductase related protein 3 protein. Length = 222 Score = 30.7 bits (66), Expect = 4.0 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 K+NI + DF LT+ ++ + N N RL H +PF Sbjct: 177 KENIQVFDFELTQHDMDNILSLNRNLRLAMFPITKNHKDYPF 218 >AB040821-1|BAC54566.1| 263|Homo sapiens aldo-keto reductase related protein 2 protein. Length = 263 Score = 30.7 bits (66), Expect = 4.0 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 K+NI + DF LT+ ++ + N N RL H +PF Sbjct: 218 KENIQVFDFELTQHDMDNILSLNRNLRLAMFPITKNHKDYPF 259 >AF263242-1|AAK58523.1| 320|Homo sapiens aldo-keto reductase loopADR protein. Length = 320 Score = 30.3 bits (65), Expect = 5.2 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 K+NI + DF LT+ ++ + N N RL H +PF Sbjct: 275 KENIQVFDFELTQHDMDNILSLNRNLRLAMFPITKNHNDYPF 316 >X15414-1|CAA33460.1| 316|Homo sapiens protein ( Human mRNA for aldose reductase (EC 1.1.1.2). ). Length = 316 Score = 29.9 bits (64), Expect = 6.9 Identities = 11/44 (25%), Positives = 23/44 (52%) Frame = +3 Query: 6 QNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPFEKK 137 +N + DF L+ +++ L +N N+R+ H +PF ++ Sbjct: 272 ENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEE 315 >M59783-1|AAA51712.1| 316|Homo sapiens aldose reductase protein. Length = 316 Score = 29.9 bits (64), Expect = 6.9 Identities = 11/44 (25%), Positives = 23/44 (52%) Frame = +3 Query: 6 QNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPFEKK 137 +N + DF L+ +++ L +N N+R+ H +PF ++ Sbjct: 272 ENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEE 315 >M34720-1|AAA35560.1| 316|Homo sapiens protein ( Human aldose reductase mRNA, complete cds. ). Length = 316 Score = 29.9 bits (64), Expect = 6.9 Identities = 11/44 (25%), Positives = 23/44 (52%) Frame = +3 Query: 6 QNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPFEKK 137 +N + DF L+ +++ L +N N+R+ H +PF ++ Sbjct: 272 ENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEE 315 >J05474-1|AAA51715.1| 316|Homo sapiens aldose reductase protein. Length = 316 Score = 29.9 bits (64), Expect = 6.9 Identities = 11/44 (25%), Positives = 23/44 (52%) Frame = +3 Query: 6 QNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPFEKK 137 +N + DF L+ +++ L +N N+R+ H +PF ++ Sbjct: 272 ENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEE 315 >J05017-1|AAA51714.1| 316|Homo sapiens ALDR1 protein. Length = 316 Score = 29.9 bits (64), Expect = 6.9 Identities = 11/44 (25%), Positives = 23/44 (52%) Frame = +3 Query: 6 QNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPFEKK 137 +N + DF L+ +++ L +N N+R+ H +PF ++ Sbjct: 272 ENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEE 315 >J04795-1|AAA51713.1| 316|Homo sapiens ALDR1 protein. Length = 316 Score = 29.9 bits (64), Expect = 6.9 Identities = 11/44 (25%), Positives = 23/44 (52%) Frame = +3 Query: 6 QNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPFEKK 137 +N + DF L+ +++ L +N N+R+ H +PF ++ Sbjct: 272 ENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEE 315 >CR542203-1|CAG47000.1| 316|Homo sapiens AKR1B1 protein. Length = 316 Score = 29.9 bits (64), Expect = 6.9 Identities = 11/44 (25%), Positives = 23/44 (52%) Frame = +3 Query: 6 QNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPFEKK 137 +N + DF L+ +++ L +N N+R+ H +PF ++ Sbjct: 272 ENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEE 315 >CR450351-1|CAG29347.1| 316|Homo sapiens AKR1B1 protein. Length = 316 Score = 29.9 bits (64), Expect = 6.9 Identities = 11/44 (25%), Positives = 23/44 (52%) Frame = +3 Query: 6 QNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPFEKK 137 +N + DF L+ +++ L +N N+R+ H +PF ++ Sbjct: 272 ENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEE 315 >BT019859-1|AAV38662.1| 316|Homo sapiens aldo-keto reductase family 1, member B1 (aldose reductase) protein. Length = 316 Score = 29.9 bits (64), Expect = 6.9 Identities = 11/44 (25%), Positives = 23/44 (52%) Frame = +3 Query: 6 QNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPFEKK 137 +N + DF L+ +++ L +N N+R+ H +PF ++ Sbjct: 272 ENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEE 315 >BC010391-1|AAH10391.1| 316|Homo sapiens aldo-keto reductase family 1, member B1 (aldose reductase) protein. Length = 316 Score = 29.9 bits (64), Expect = 6.9 Identities = 11/44 (25%), Positives = 23/44 (52%) Frame = +3 Query: 6 QNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPFEKK 137 +N + DF L+ +++ L +N N+R+ H +PF ++ Sbjct: 272 ENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEE 315 >BC005387-1|AAH05387.1| 316|Homo sapiens aldo-keto reductase family 1, member B1 (aldose reductase) protein. Length = 316 Score = 29.9 bits (64), Expect = 6.9 Identities = 11/44 (25%), Positives = 23/44 (52%) Frame = +3 Query: 6 QNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPFEKK 137 +N + DF L+ +++ L +N N+R+ H +PF ++ Sbjct: 272 ENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEE 315 >BC000260-1|AAH00260.1| 316|Homo sapiens aldo-keto reductase family 1, member B1 (aldose reductase) protein. Length = 316 Score = 29.9 bits (64), Expect = 6.9 Identities = 11/44 (25%), Positives = 23/44 (52%) Frame = +3 Query: 6 QNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPFEKK 137 +N + DF L+ +++ L +N N+R+ H +PF ++ Sbjct: 272 ENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEE 315 >AF328729-1|AAN09721.1| 316|Homo sapiens CTCL tumor antigen HD-CL-07 protein. Length = 316 Score = 29.9 bits (64), Expect = 6.9 Identities = 11/44 (25%), Positives = 23/44 (52%) Frame = +3 Query: 6 QNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPFEKK 137 +N + DF L+ +++ L +N N+R+ H +PF ++ Sbjct: 272 ENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEE 315 >AF032455-1|AAB88851.1| 316|Homo sapiens aldose reductase protein. Length = 316 Score = 29.9 bits (64), Expect = 6.9 Identities = 11/44 (25%), Positives = 23/44 (52%) Frame = +3 Query: 6 QNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPFEKK 137 +N + DF L+ +++ L +N N+R+ H +PF ++ Sbjct: 272 ENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEE 315 >S68288-1|AAD14011.1| 323|Homo sapiens chlordecone reductase homolog protein. Length = 323 Score = 29.5 bits (63), Expect = 9.1 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 +QN+ + +F LT E++ + + N + HP +P+ Sbjct: 278 RQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPY 319 >L43839-1|AAB41916.1| 323|Homo sapiens 3-alpha-hydroxysteroid dehydrogenase protein. Length = 323 Score = 29.5 bits (63), Expect = 9.1 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 +QN+ + +F LT E++ + + N + HP +P+ Sbjct: 278 RQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPY 319 >D17793-1|BAA04619.2| 325|Homo sapiens KIAA0119 protein. Length = 325 Score = 29.5 bits (63), Expect = 9.1 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 +QN+ + +F LT E++ + + N + HP +P+ Sbjct: 280 RQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPY 321 >DQ269985-1|ABB76132.1| 323|Homo sapiens type II 3a-hydroxysteroid dehydrogenase variant protein. Length = 323 Score = 29.5 bits (63), Expect = 9.1 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 +QN+ + +F LT E++ + + N + HP +P+ Sbjct: 278 RQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPY 319 >BT007286-1|AAP35950.1| 323|Homo sapiens aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, protein. Length = 323 Score = 29.5 bits (63), Expect = 9.1 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 +QN+ + +F LT E++ + + N + HP +P+ Sbjct: 278 RQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPY 319 >BC019230-1|AAH19230.1| 323|Homo sapiens aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, protein. Length = 323 Score = 29.5 bits (63), Expect = 9.1 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 +QN+ + +F LT E++ + + N + HP +P+ Sbjct: 278 RQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPY 319 >BC001479-1|AAH01479.1| 323|Homo sapiens aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, protein. Length = 323 Score = 29.5 bits (63), Expect = 9.1 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 +QN+ + +F LT E++ + + N + HP +P+ Sbjct: 278 RQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPY 319 >AL391427-4|CAI14729.1| 323|Homo sapiens aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, protein. Length = 323 Score = 29.5 bits (63), Expect = 9.1 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 +QN+ + +F LT E++ + + N + HP +P+ Sbjct: 278 RQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPY 319 >AF149416-1|AAF07272.2| 323|Homo sapiens 3-alpha hydroxysteroid dehydrogenase type IIb protein. Length = 323 Score = 29.5 bits (63), Expect = 9.1 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 +QN+ + +F LT E++ + + N + HP +P+ Sbjct: 278 RQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPY 319 >AB032157-1|BAA92892.1| 323|Homo sapiens prostaglandin F synthase protein. Length = 323 Score = 29.5 bits (63), Expect = 9.1 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 +QN+ + +F LT E++ + + N + HP +P+ Sbjct: 278 RQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPY 319 >AB018580-1|BAA88488.1| 323|Homo sapiens hluPGFS protein. Length = 323 Score = 29.5 bits (63), Expect = 9.1 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 3 KQNIDIIDFNLTREEVAKLSQFNSNYRLRTPAKWYPHPYFPF 128 +QN+ + +F LT E++ + + N + HP +P+ Sbjct: 278 RQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPY 319 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 70,422,549 Number of Sequences: 237096 Number of extensions: 1356446 Number of successful extensions: 1670 Number of sequences better than 10.0: 77 Number of HSP's better than 10.0 without gapping: 1644 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1668 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 6098631048 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -