BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_P20 (201 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. 44 7e-07 AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. 44 7e-07 AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. 44 7e-07 AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. 44 7e-07 L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase pro... 40 8e-06 AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase p... 40 8e-06 AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8... 39 2e-05 AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7... 39 2e-05 AJ010194-1|CAA09033.1| 684|Anopheles gambiae prophenoloxidase p... 39 2e-05 AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase p... 36 1e-04 AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase... 36 2e-04 AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase p... 35 4e-04 AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9... 31 0.004 AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase... 27 0.061 M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 25 0.43 AY280613-1|AAQ21366.1| 257|Anopheles gambiae carbonic anhydrase... 22 2.3 AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. 22 3.0 AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 21 4.0 AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 21 4.0 DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormo... 21 5.3 AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled ... 21 5.3 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 21 5.3 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 21 7.0 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 21 7.0 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 20 9.3 AY324312-1|AAQ89697.1| 158|Anopheles gambiae insulin-like pepti... 20 9.3 AY324311-1|AAQ89696.1| 158|Anopheles gambiae insulin-like pepti... 20 9.3 AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 20 9.3 >U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. Length = 692 Score = 44.0 bits (99), Expect = 7e-07 Identities = 18/47 (38%), Positives = 28/47 (59%) Frame = +2 Query: 2 YFHSHLPFWWSSERYGNLKHRRGEIYYNFYQQLTTRYYFERLTNGLG 142 YF F +++G +K RRGE+Y+ +Q L RY ER++N +G Sbjct: 237 YFMMDYSFLLGGDKFGLIKDRRGELYWYMHQMLLARYNLERMSNYMG 283 >AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 44.0 bits (99), Expect = 7e-07 Identities = 18/47 (38%), Positives = 28/47 (59%) Frame = +2 Query: 2 YFHSHLPFWWSSERYGNLKHRRGEIYYNFYQQLTTRYYFERLTNGLG 142 YF F +++G +K RRGE+Y+ +Q L RY ER++N +G Sbjct: 237 YFMMDYSFLLGGDKFGLIKDRRGELYWYMHQMLLARYNLERMSNYMG 283 >AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 44.0 bits (99), Expect = 7e-07 Identities = 18/47 (38%), Positives = 28/47 (59%) Frame = +2 Query: 2 YFHSHLPFWWSSERYGNLKHRRGEIYYNFYQQLTTRYYFERLTNGLG 142 YF F +++G +K RRGE+Y+ +Q L RY ER++N +G Sbjct: 237 YFMMDYSFLLGGDKFGLIKDRRGELYWYMHQMLLARYNLERMSNYMG 283 >AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 44.0 bits (99), Expect = 7e-07 Identities = 18/47 (38%), Positives = 28/47 (59%) Frame = +2 Query: 2 YFHSHLPFWWSSERYGNLKHRRGEIYYNFYQQLTTRYYFERLTNGLG 142 YF F +++G +K RRGE+Y+ +Q L RY ER++N +G Sbjct: 237 YFMMDYSFLLGGDKFGLIKDRRGELYWYMHQMLLARYNLERMSNYMG 283 >L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 40.3 bits (90), Expect = 8e-06 Identities = 19/47 (40%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Frame = +2 Query: 2 YFHSHLPFWWSSERYGNL-KHRRGEIYYNFYQQLTTRYYFERLTNGL 139 ++H HL + + + + K RRGE++Y +QQL RY FER +N L Sbjct: 207 HWHWHLVYPFDASNRAIVDKDRRGELFYYMHQQLVARYNFERFSNRL 253 >AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 40.3 bits (90), Expect = 8e-06 Identities = 19/47 (40%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Frame = +2 Query: 2 YFHSHLPFWWSSERYGNL-KHRRGEIYYNFYQQLTTRYYFERLTNGL 139 ++H HL + + + + K RRGE++Y +QQL RY FER +N L Sbjct: 207 HWHWHLVYPFDASNRAIVDKDRRGELFYYMHQQLVARYNFERFSNRL 253 >AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8 protein. Length = 700 Score = 39.1 bits (87), Expect = 2e-05 Identities = 19/47 (40%), Positives = 26/47 (55%) Frame = +2 Query: 2 YFHSHLPFWWSSERYGNLKHRRGEIYYNFYQQLTTRYYFERLTNGLG 142 ++H HL + S K RRGE++Y +QQL RY +R GLG Sbjct: 223 HWHWHLVYPASGPPDVVRKDRRGELFYYMHQQLLARYQIDRYAQGLG 269 >AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7 protein. Length = 696 Score = 39.1 bits (87), Expect = 2e-05 Identities = 18/47 (38%), Positives = 26/47 (55%) Frame = +2 Query: 2 YFHSHLPFWWSSERYGNLKHRRGEIYYNFYQQLTTRYYFERLTNGLG 142 ++H HL + K RRGE++Y +QQ+ RY ER + GLG Sbjct: 222 HWHWHLVYPAEGPERVVRKDRRGELFYYMHQQMIARYQVERYSQGLG 268 >AJ010194-1|CAA09033.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 39.1 bits (87), Expect = 2e-05 Identities = 19/51 (37%), Positives = 28/51 (54%) Frame = +2 Query: 2 YFHSHLPFWWSSERYGNLKHRRGEIYYNFYQQLTTRYYFERLTNGLGPYLN 154 ++H HL + + K RRGE++Y+ +QQ RY ER NGL L+ Sbjct: 209 HWHWHLVYPATGPDRVVRKDRRGELFYHMHQQTIARYNIERFANGLARTLS 259 >AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 36.3 bits (80), Expect = 1e-04 Identities = 17/46 (36%), Positives = 24/46 (52%) Frame = +2 Query: 2 YFHSHLPFWWSSERYGNLKHRRGEIYYNFYQQLTTRYYFERLTNGL 139 ++H HL + K RRGE++Y +QQ RY ER NG+ Sbjct: 209 HWHWHLVYPARGPNRIVRKDRRGELFYYMHQQTMARYNIERFANGM 254 >AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase subunit 2 protein. Length = 686 Score = 35.5 bits (78), Expect = 2e-04 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = +2 Query: 2 YFHSHLPFWWSS-ERYGNLKHRRGEIYYNFYQQLTTRYYFERLTNGL 139 ++H HL + +R N K RRGE++Y +QQL RY ER N L Sbjct: 208 HWHWHLVYPGEGPDRVVN-KDRRGELFYYMHQQLIARYNVERFCNRL 253 >AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase protein. Length = 687 Score = 34.7 bits (76), Expect = 4e-04 Identities = 17/46 (36%), Positives = 24/46 (52%) Frame = +2 Query: 2 YFHSHLPFWWSSERYGNLKHRRGEIYYNFYQQLTTRYYFERLTNGL 139 ++H HL + K RRGE++Y +QQL RY +R N L Sbjct: 209 HWHWHLVYPGEGPNNVVNKDRRGELFYYMHQQLIARYNVDRFCNRL 254 >AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9 protein. Length = 685 Score = 31.5 bits (68), Expect = 0.004 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +2 Query: 56 KHRRGEIYYNFYQQLTTRYYFERLTNGL 139 K RRGE++Y ++Q RY ER N L Sbjct: 227 KDRRGELFYYMHRQTVARYNVERFCNRL 254 >AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase subunit 1 protein. Length = 688 Score = 27.5 bits (58), Expect = 0.061 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +2 Query: 2 YFHSHLPFWWSSERYGNLKHRRGEIYYNFYQQLTTRYYFER 124 ++H HL + K RRGE+++ + QL RY +R Sbjct: 208 HWHWHLVYPGDGPDEVVRKDRRGELFFYMHSQLIARYNADR 248 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 24.6 bits (51), Expect = 0.43 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -2 Query: 113 NNVLLIVGRNCNIFRHG 63 NN LL + +NCN FR+G Sbjct: 78 NNQLLWLCKNCNEFRNG 94 >AY280613-1|AAQ21366.1| 257|Anopheles gambiae carbonic anhydrase alternate isoform protein. Length = 257 Score = 22.2 bits (45), Expect = 2.3 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 Query: 77 YYNFYQQLTTRYYFERLT 130 YY + LTT YFE +T Sbjct: 178 YYTYKGSLTTPPYFESVT 195 >AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. Length = 506 Score = 21.8 bits (44), Expect = 3.0 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +2 Query: 14 HLPFWWSSERYGNLKHRRGEIYYNFYQQLT 103 H P +W S Y L R GE ++ +T Sbjct: 308 HEPTFWCSISYYELNLRVGETFHASQPSIT 337 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 21.4 bits (43), Expect = 4.0 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +2 Query: 20 PFWWSSERYGNLKHRRGEIYY 82 P +W+S Y L R GE+++ Sbjct: 277 PPYWASIAYYELNCRVGEVFH 297 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 21.4 bits (43), Expect = 4.0 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +2 Query: 68 GEIYYNFYQQLTTRYYFE 121 G++ NF+ Q + R YF+ Sbjct: 1575 GQVLLNFFPQKSMRGYFD 1592 >DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormone receptor protein. Length = 354 Score = 21.0 bits (42), Expect = 5.3 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +2 Query: 59 HRRGEIYYNFYQQLTTRYYFE 121 H G YQQ T +YFE Sbjct: 184 HLEGHPNITGYQQCVTYHYFE 204 >AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled receptor protein. Length = 354 Score = 21.0 bits (42), Expect = 5.3 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +2 Query: 59 HRRGEIYYNFYQQLTTRYYFE 121 H G YQQ T +YFE Sbjct: 184 HLEGHPNITGYQQCVTYHYFE 204 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 21.0 bits (42), Expect = 5.3 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -2 Query: 125 DARSNNVLLIVGRNCNI 75 D +NN+ IV +CNI Sbjct: 2 DTVTNNIRTIVNGSCNI 18 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 20.6 bits (41), Expect = 7.0 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -2 Query: 173 IGEYQENSGMDPSRL*DARSN 111 +G + N+G P +L DA+S+ Sbjct: 912 LGRERNNAGYTPLQLADAKSH 932 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 20.6 bits (41), Expect = 7.0 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = +2 Query: 53 LKHRRGEIYYNFYQQLTTRYYFERLTNGLG 142 + R GE+ ++ Q LT YF + G Sbjct: 914 MSRRHGEVDFHLSQVLTGHGYFREYLHVCG 943 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 20.2 bits (40), Expect = 9.3 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -3 Query: 79 IYFATAMLKVTISLRTPPERQ 17 ++ + KV + TPPERQ Sbjct: 486 LFLCDCVSKVRAAPPTPPERQ 506 >AY324312-1|AAQ89697.1| 158|Anopheles gambiae insulin-like peptide 5 precursor protein. Length = 158 Score = 20.2 bits (40), Expect = 9.3 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 Query: 4 LPLALAFLVEF*EI 45 LPLAL L+EF +I Sbjct: 3 LPLALCVLLEFADI 16 >AY324311-1|AAQ89696.1| 158|Anopheles gambiae insulin-like peptide 5 precursor protein. Length = 158 Score = 20.2 bits (40), Expect = 9.3 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 Query: 4 LPLALAFLVEF*EI 45 LPLAL L+EF +I Sbjct: 3 LPLALCVLLEFADI 16 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 20.2 bits (40), Expect = 9.3 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 Query: 152 SGMDPSRL*DARSNNVLLIVGRNCNIFRH 66 S DP L R+ VL IV +N RH Sbjct: 72 SSQDPDGLSLFRNGKVLKIVLKNFMCHRH 100 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 220,430 Number of Sequences: 2352 Number of extensions: 3733 Number of successful extensions: 28 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 44 effective length of database: 460,491 effective search space used: 10130802 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -