BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_P19 (565 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0991 - 21500143-21500799,21500834-21501172 30 1.1 11_06_0181 + 20985960-20987825,20987904-20989169 29 1.9 05_03_0488 - 14651532-14652265,14652404-14653988 29 2.6 08_01_0095 + 686182-686184,686440-686682,686755-687228 29 3.4 06_03_0629 + 22920206-22920291,22920430-22920527,22920657-229207... 27 7.8 03_06_0120 + 31804301-31804412,31804525-31804631,31804714-318047... 27 7.8 >04_03_0991 - 21500143-21500799,21500834-21501172 Length = 331 Score = 30.3 bits (65), Expect = 1.1 Identities = 22/84 (26%), Positives = 37/84 (44%) Frame = +2 Query: 134 TRVNQETESHFVVSGLSAWAILSTLSFGAAEETFDEINTVLRLHPHVCFNRKYFNILKEI 313 T V ++ H + GL A + ++F + +TF VL V F + F KE+ Sbjct: 154 TVVVPPSDLHRHLGGLLATGEGADVTFEVSGKTFAAHRLVLAARSPV-FRAELFGPSKEL 212 Query: 314 GKNDGGVLEHSGAMFIDSKINVYE 385 G GG ++H+ D + +E Sbjct: 213 GATTGGAVDHTAIRIDDMEARDFE 236 >11_06_0181 + 20985960-20987825,20987904-20989169 Length = 1043 Score = 29.5 bits (63), Expect = 1.9 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = -2 Query: 411 VFWTSCLNCS*TFIFESMNIAPECSKTPPSFLPI 310 VFWT C +C F++ N CS F I Sbjct: 167 VFWTICPHCQKRFLYYQRNFLARCSDCGKRFFAI 200 >05_03_0488 - 14651532-14652265,14652404-14653988 Length = 772 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = +2 Query: 356 FIDSKINVYEQFK-QDVQNTGVSEVNELPW 442 F+D+ +N E FK QDV + ++ +N +PW Sbjct: 387 FVDAILNGLEVFKLQDVNKSNLAGMNPIPW 416 >08_01_0095 + 686182-686184,686440-686682,686755-687228 Length = 239 Score = 28.7 bits (61), Expect = 3.4 Identities = 29/104 (27%), Positives = 47/104 (45%), Gaps = 1/104 (0%) Frame = +2 Query: 59 YGKCNDYTAHQFLKRSLYDFNAGLVTRVNQETESHFVVSGL-SAWAILSTLSFGAAEETF 235 Y YT QF L D A +TR+ + FVV+G+ S I + L+ Sbjct: 58 YNTRRRYTPRQFADL-LADRYAAQLTRLYKAGARKFVVAGVGSMGCIPNVLAQSVESRCS 116 Query: 236 DEINTVLRLHPHVCFNRKYFNILKEIGKNDGGVLEHSGAMFIDS 367 E++ ++ V FN N+ +G+ DGG L + +F+D+ Sbjct: 117 PEVDALV-----VPFNA---NVRAMLGRLDGGGLPGASLVFLDN 152 >06_03_0629 + 22920206-22920291,22920430-22920527,22920657-22920796, 22921596-22921626,22922025-22922128,22922439-22922560, 22922651-22923050,22923245-22923268 Length = 334 Score = 27.5 bits (58), Expect = 7.8 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = +1 Query: 109 VRLQRWTSDESQSRNGKPFRRIWTISMGNSI 201 + ++ W+S S S P R+ W +S+ N++ Sbjct: 61 IMIKLWSSGGSSSAGRAPLRKYWGVSITNTV 91 >03_06_0120 + 31804301-31804412,31804525-31804631,31804714-31804756, 31806069-31806187 Length = 126 Score = 27.5 bits (58), Expect = 7.8 Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = -2 Query: 258 LSTVLISSKVSSA-APNDSVDRIAHADSPDTTKWLSVS*LTLVTSPALKSYN 106 L ++ +K ++A A + AH D+ +T KW ++ +VT L +YN Sbjct: 10 LRSLAARAKATAAPAARRRMSSSAHDDAHETAKWEKITYAGIVTCTLLAAYN 61 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,931,063 Number of Sequences: 37544 Number of extensions: 236004 Number of successful extensions: 526 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 521 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 526 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1293275844 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -