BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_P18 (539 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15683| Best HMM Match : Y_phosphatase (HMM E-Value=0) 30 1.4 SB_58464| Best HMM Match : S1-P1_nuclease (HMM E-Value=6.9) 29 3.2 SB_52620| Best HMM Match : Y_phosphatase (HMM E-Value=9.3e-06) 29 3.2 SB_45383| Best HMM Match : HDV_ag (HMM E-Value=1.9) 29 3.2 SB_54099| Best HMM Match : Y_phosphatase (HMM E-Value=1.3) 28 4.2 SB_50464| Best HMM Match : Y_phosphatase (HMM E-Value=1.3) 28 4.2 SB_12083| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_5167| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_55161| Best HMM Match : Kunitz_BPTI (HMM E-Value=6.3) 27 7.4 SB_36205| Best HMM Match : ADH_zinc_N (HMM E-Value=0.00092) 27 9.8 SB_22572| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_45475| Best HMM Match : RhoGAP (HMM E-Value=1.26117e-44) 27 9.8 >SB_15683| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 753 Score = 29.9 bits (64), Expect = 1.4 Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = +2 Query: 29 IETSE--MILTITVLSALVTQASLTPLSNLTVAFINYEELSPLNNINSYE 172 ++TSE + + + VL ALV ++ P N+ A + +L N++ YE Sbjct: 700 VQTSEQYVFIHLAVLEALVCGSTDIPADNMKAAMVRLSKLRTPGNVSGYE 749 >SB_58464| Best HMM Match : S1-P1_nuclease (HMM E-Value=6.9) Length = 403 Score = 28.7 bits (61), Expect = 3.2 Identities = 15/29 (51%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -1 Query: 86 LASPVHSAP-LSLKSFRWSRFAVVSLSRF 3 LA PV +P +SL+ R +RFAV ++SRF Sbjct: 312 LAKPVQISPSMSLRGERNTRFAVFAISRF 340 >SB_52620| Best HMM Match : Y_phosphatase (HMM E-Value=9.3e-06) Length = 324 Score = 28.7 bits (61), Expect = 3.2 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Frame = +2 Query: 29 IETSE--MILTITVLSALVTQASLTPLSNLTVAFINYEELSPLNNINSYEQLYDSVVV 196 ++TSE + + + VL ALV ++ P N+ A +L N++ YE + + V Sbjct: 246 VQTSEQYVFIHLAVLEALVCGSTDIPADNMKAAMARLSKLRTPENVSGYEAEFQRLSV 303 >SB_45383| Best HMM Match : HDV_ag (HMM E-Value=1.9) Length = 444 Score = 28.7 bits (61), Expect = 3.2 Identities = 18/70 (25%), Positives = 31/70 (44%), Gaps = 1/70 (1%) Frame = +2 Query: 107 NLTVAFINYEELSPLNNINSYEQLYDSVVVGDYKAAVMKTLRLENDGKGEVINLVVNRLL 286 NLT L + + N + Q YD + + +A + E D G I N+ L Sbjct: 8 NLTGKLCQEVRLEGVGSGNPFAQPYDGIKLSSMRAKAADEMADEGDDAGAAIVQARNKFL 67 Query: 287 SEG-KRNIVE 313 ++ K+N++E Sbjct: 68 TQVLKKNMIE 77 >SB_54099| Best HMM Match : Y_phosphatase (HMM E-Value=1.3) Length = 97 Score = 28.3 bits (60), Expect = 4.2 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 2/50 (4%) Frame = +2 Query: 29 IETSE--MILTITVLSALVTQASLTPLSNLTVAFINYEELSPLNNINSYE 172 ++TSE + + + VL ALV ++ P N+ A +L N++ YE Sbjct: 43 VQTSEQYVFIHLAVLEALVCGSTDIPADNMKAAMARLSKLRTPGNVSGYE 92 >SB_50464| Best HMM Match : Y_phosphatase (HMM E-Value=1.3) Length = 96 Score = 28.3 bits (60), Expect = 4.2 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 2/50 (4%) Frame = +2 Query: 29 IETSE--MILTITVLSALVTQASLTPLSNLTVAFINYEELSPLNNINSYE 172 ++TSE + + + VL ALV ++ P N+ A +L N++ YE Sbjct: 43 VQTSEQYVFIHLAVLEALVCGSTDIPADNMKAAMARLSKLRTPENVSGYE 92 >SB_12083| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1671 Score = 28.3 bits (60), Expect = 4.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 43 NDFNDNGAECTGDASVPYTSK 105 N FN N AEC PYTSK Sbjct: 1395 NMFNGNSAECKNKHGQPYTSK 1415 >SB_5167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 547 Score = 28.3 bits (60), Expect = 4.2 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 19 TTANRDQRNDFNDNGAECTG 78 T NRD+R DF DNG +G Sbjct: 16 TDKNRDERKDFKDNGKRQSG 35 >SB_55161| Best HMM Match : Kunitz_BPTI (HMM E-Value=6.3) Length = 260 Score = 27.5 bits (58), Expect = 7.4 Identities = 29/75 (38%), Positives = 36/75 (48%), Gaps = 7/75 (9%) Frame = +1 Query: 13 RETTA--NRDQRND--FN--DNGAE-CTGDASVPYTSKQPHGCIY*LRRAFATQ*HQLLR 171 +ETTA N + RN+ F D AE C+G V Y + P+GC A HQLL Sbjct: 109 KETTACVNVNNRNNGCFRSIDMCAEMCSGGYYVYYL-RPPYGCSM-AYCAGRFSGHQLLE 166 Query: 172 TVVRQCSCRRLQGCS 216 V R C + GCS Sbjct: 167 LVTRGKRCVTMNGCS 181 >SB_36205| Best HMM Match : ADH_zinc_N (HMM E-Value=0.00092) Length = 676 Score = 27.1 bits (57), Expect = 9.8 Identities = 21/78 (26%), Positives = 39/78 (50%), Gaps = 2/78 (2%) Frame = +2 Query: 98 PLSNLTVAFINYEELSPLNNINSYEQLYDSVVVGDYKAAVMKTLRLENDGKGEVINLVVN 277 P+S +T A + + IN + D V+ +Y + + E+ G GE+ + VN Sbjct: 130 PISGMTAALSLEKSIGCDRPINYKTESLDKVLNKEYPKGI--DVIYESIG-GEIFDTCVN 186 Query: 278 RLLSEGKRNIVEY--AYK 325 RL ++G+ ++ + AYK Sbjct: 187 RLATKGRIIVIGFITAYK 204 >SB_22572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 537 Score = 27.1 bits (57), Expect = 9.8 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = +1 Query: 70 CTGDASVPYTSKQPHGCIY*LRRAFATQ*HQLLRTVVRQCSCRRLQGCS 216 C+G V Y + P+GC F+ HQLL V + C + GCS Sbjct: 395 CSGGYYVYYL-RPPYGCSMAYCAGFSG--HQLLELVTQGKRCVTMNGCS 440 >SB_45475| Best HMM Match : RhoGAP (HMM E-Value=1.26117e-44) Length = 552 Score = 27.1 bits (57), Expect = 9.8 Identities = 15/64 (23%), Positives = 29/64 (45%) Frame = +2 Query: 167 YEQLYDSVVVGDYKAAVMKTLRLENDGKGEVINLVVNRLLSEGKRNIVEYAYKLWNMFGT 346 + QL + ++ Y + +KT+R+E+D L + LL ++Y K F + Sbjct: 252 FRQLQEPLLTNTYHDSFIKTMRIEDDNTRTKAMLYICLLLPLAHLQALKYTMKFLAEFAS 311 Query: 347 NIVK 358 + K Sbjct: 312 HSEK 315 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,380,240 Number of Sequences: 59808 Number of extensions: 281275 Number of successful extensions: 823 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 742 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 819 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1227799733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -