BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_P18 (539 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 24 3.7 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 6.5 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 23 6.5 AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. 23 8.7 AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. 23 8.7 AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. 23 8.7 AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. 23 8.7 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.8 bits (49), Expect = 3.7 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = +2 Query: 278 RLLSEGKRNIVEYAYKLWNMFGTNIVKDHFPK 373 R LS+ +RN+ + W + + H PK Sbjct: 454 RYLSKIQRNLCRWPDSFWRFYNSKTKSTHTPK 485 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.0 bits (47), Expect = 6.5 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +2 Query: 59 TVLSALVTQASLTPLS 106 T LSALV Q S+TPL+ Sbjct: 1301 TSLSALVYQHSITPLA 1316 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 23.0 bits (47), Expect = 6.5 Identities = 6/19 (31%), Positives = 14/19 (73%) Frame = -2 Query: 370 WEVIFDYVRAEHVP*FVSV 314 WEV+ DY+ ++H+ +++ Sbjct: 190 WEVLPDYMNSDHIGILITI 208 >AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. Length = 285 Score = 22.6 bits (46), Expect = 8.7 Identities = 12/51 (23%), Positives = 25/51 (49%) Frame = +2 Query: 368 PKEFRMFLNEDPVLIINKRDELALKLQLSMDNDGDRASFGDGADKTSHRLS 520 P ++ NE+ + R + ++ Q+ MD+ G + G ++ SH +S Sbjct: 162 PSYNQLNYNENLQRFFDSRPAMNIEEQMKMDSSGGTNTETIGDEQQSHAVS 212 >AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. Length = 285 Score = 22.6 bits (46), Expect = 8.7 Identities = 12/51 (23%), Positives = 25/51 (49%) Frame = +2 Query: 368 PKEFRMFLNEDPVLIINKRDELALKLQLSMDNDGDRASFGDGADKTSHRLS 520 P ++ NE+ + R + ++ Q+ MD+ G + G ++ SH +S Sbjct: 162 PSYNQLNYNENLQRFFDSRPAMNIEEQMKMDSSGGTNTETIGDEQQSHAVS 212 >AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. Length = 285 Score = 22.6 bits (46), Expect = 8.7 Identities = 12/51 (23%), Positives = 25/51 (49%) Frame = +2 Query: 368 PKEFRMFLNEDPVLIINKRDELALKLQLSMDNDGDRASFGDGADKTSHRLS 520 P ++ NE+ + R + ++ Q+ MD+ G + G ++ SH +S Sbjct: 162 PSYNQLNYNENLQRFFDSRPAMNIEEQMKMDSSGGTNTETIGDEQQSHAVS 212 >AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. Length = 285 Score = 22.6 bits (46), Expect = 8.7 Identities = 12/51 (23%), Positives = 25/51 (49%) Frame = +2 Query: 368 PKEFRMFLNEDPVLIINKRDELALKLQLSMDNDGDRASFGDGADKTSHRLS 520 P ++ NE+ + R + ++ Q+ MD+ G + G ++ SH +S Sbjct: 162 PSYNQLNYNENLQRFFDSRPAMNIEEQMKMDSSGGTNTETIGDEQQSHAVS 212 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 508,686 Number of Sequences: 2352 Number of extensions: 9597 Number of successful extensions: 12 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 50320221 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -