BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_P18 (539 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 24 0.86 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 24 0.86 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 24 0.86 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 24 0.86 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 24 0.86 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 24 0.86 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 24 0.86 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 24 1.1 AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective... 23 2.0 AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 21 6.1 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 21 8.1 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 21 8.1 AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydroge... 21 8.1 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 24.2 bits (50), Expect = 0.86 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +2 Query: 92 LTPLSNLTVAFINYEELSPLNNINSYEQLYDSV 190 ++ LSN + NY + NN N+Y++LY ++ Sbjct: 82 ISSLSN-NYNYSNYNNYNNNNNYNNYKKLYYNI 113 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 0.86 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +2 Query: 92 LTPLSNLTVAFINYEELSPLNNINSYEQLYDSV 190 ++ LSN + NY + NN N+Y++LY ++ Sbjct: 82 ISSLSN-NYNYSNYNNYNNNNNYNNYKKLYYNI 113 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 0.86 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +2 Query: 92 LTPLSNLTVAFINYEELSPLNNINSYEQLYDSV 190 ++ LSN + NY + NN N+Y++LY ++ Sbjct: 82 ISSLSN-NYNYSNYNNYNNNNNYNNYKKLYYNI 113 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 0.86 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +2 Query: 92 LTPLSNLTVAFINYEELSPLNNINSYEQLYDSV 190 ++ LSN + NY + NN N+Y++LY ++ Sbjct: 82 ISSLSN-NYNYSNYNNYNNNNNYNNYKKLYYNI 113 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 0.86 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +2 Query: 92 LTPLSNLTVAFINYEELSPLNNINSYEQLYDSV 190 ++ LSN + NY + NN N+Y++LY ++ Sbjct: 82 ISSLSN-NYNYSNYNNYNNNNNYNNYKKLYYNI 113 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 0.86 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +2 Query: 92 LTPLSNLTVAFINYEELSPLNNINSYEQLYDSV 190 ++ LSN + NY + NN N+Y++LY ++ Sbjct: 82 ISSLSN-NYNYSNYNNYNNNNNYNNYKKLYYNI 113 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 0.86 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +2 Query: 92 LTPLSNLTVAFINYEELSPLNNINSYEQLYDSV 190 ++ LSN + NY + NN N+Y++LY ++ Sbjct: 82 ISSLSN-NYNYSNYNNYNNNNNYNNYKKLYYNI 113 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 1.1 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +2 Query: 92 LTPLSNLTVAFINYEELSPLNNINSYEQLYDSV 190 ++ LSN + NY + NN N+Y++LY ++ Sbjct: 82 VSSLSN-NYNYSNYNNYNNNNNYNNYKKLYYNI 113 >AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective protein-1 protein. Length = 128 Score = 23.0 bits (47), Expect = 2.0 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 184 QCSCRRLQGCSNE 222 QCSC + GCS E Sbjct: 84 QCSCNKCIGCSAE 96 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 21.4 bits (43), Expect = 6.1 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +1 Query: 76 GDASVPYTSKQPHGC 120 G++ V T++ PHGC Sbjct: 267 GESEVFDTTRYPHGC 281 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 21.0 bits (42), Expect = 8.1 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 368 PKEFRMFLNEDPVLIINK 421 PK FL + PV +IN+ Sbjct: 145 PKNTNKFLEKGPVALINE 162 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.0 bits (42), Expect = 8.1 Identities = 6/14 (42%), Positives = 12/14 (85%) Frame = +2 Query: 152 NNINSYEQLYDSVV 193 NN N+Y++LY +++ Sbjct: 344 NNYNNYKKLYYNII 357 >AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydrogenase/reductase protein. Length = 246 Score = 21.0 bits (42), Expect = 8.1 Identities = 5/12 (41%), Positives = 11/12 (91%) Frame = -2 Query: 160 DVIEWRKLFVVN 125 +V++W+K+F +N Sbjct: 104 EVLDWKKIFDIN 115 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,044 Number of Sequences: 438 Number of extensions: 2553 Number of successful extensions: 15 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15336375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -