BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_P18 (539 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g17270.1 68414.m02103 expressed protein 27 6.1 At1g06720.1 68414.m00714 expressed protein contains Pfam domain,... 27 8.0 >At1g17270.1 68414.m02103 expressed protein Length = 564 Score = 27.5 bits (58), Expect = 6.1 Identities = 16/60 (26%), Positives = 30/60 (50%) Frame = +2 Query: 65 LSALVTQASLTPLSNLTVAFINYEELSPLNNINSYEQLYDSVVVGDYKAAVMKTLRLEND 244 +S+ V ++ L L+ L + L N NS + SVV+ + KAA++K + + + Sbjct: 102 MSSRVKESELQALNLLRQQQLALVSLLNRTNFNSSNAISSSVVIDNVKAALLKQISVNKE 161 >At1g06720.1 68414.m00714 expressed protein contains Pfam domain, PF04950: Protein of unknown function (DUF663) Length = 1147 Score = 27.1 bits (57), Expect = 8.0 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = +2 Query: 122 FINYEELSPLNNINSYEQLYDSVVVGDYKAAVMKTLRLENDGKGE 256 F+NY L E + D GD+ A ++ L G+GE Sbjct: 619 FVNYGYLKNWKEKEVCESIRDRFTTGDWSKAALRDKNLGTGGEGE 663 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,573,445 Number of Sequences: 28952 Number of extensions: 190356 Number of successful extensions: 560 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 553 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 560 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1003808112 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -