BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_P17 (434 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC354.15 |fap1||L-pipecolate oxidase|Schizosaccharomyces pombe... 26 2.2 SPCC1450.16c |||triacylglycerol lipase|Schizosaccharomyces pombe... 25 5.0 SPAC25B8.15c |||wybutosine biosynthesis protein Tyw3|Schizosacch... 25 5.0 >SPBC354.15 |fap1||L-pipecolate oxidase|Schizosaccharomyces pombe|chr 2|||Manual Length = 412 Score = 26.2 bits (55), Expect = 2.2 Identities = 9/31 (29%), Positives = 20/31 (64%) Frame = +2 Query: 137 NDRSYWLSTGQPIPMMPVEGNEIVKYISRCV 229 ND + +L+TGQP+ + + E +++++ V Sbjct: 215 NDHTRFLATGQPVAYIKLTPEEYIRFLTNPV 245 >SPCC1450.16c |||triacylglycerol lipase|Schizosaccharomyces pombe|chr 3|||Manual Length = 513 Score = 25.0 bits (52), Expect = 5.0 Identities = 8/33 (24%), Positives = 16/33 (48%) Frame = -2 Query: 295 WATWNV*CLAVDSYNIRWHFAYNTSRNVFYYLI 197 W W V +D + RW + + + + + YL+ Sbjct: 57 WEDWKVLATTIDKASGRWKWRFTPASDKYDYLL 89 >SPAC25B8.15c |||wybutosine biosynthesis protein Tyw3|Schizosaccharomyces pombe|chr 1|||Manual Length = 237 Score = 25.0 bits (52), Expect = 5.0 Identities = 14/49 (28%), Positives = 24/49 (48%) Frame = +2 Query: 173 IPMMPVEGNEIVKYISRCVVCEVPSNVIAVHSQTLDIPGCPVGWSELWI 319 +P PVEGN ++Y ++ V + +A ++Q L G+ E I Sbjct: 102 VPSSPVEGNREIQYAFEPMILHVQTRSLA-NAQHLQRVAASCGFRETGI 149 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,798,935 Number of Sequences: 5004 Number of extensions: 35255 Number of successful extensions: 65 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 65 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 156095170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -