BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_P16 (580 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 23 2.9 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 22 5.0 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 22 5.0 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 22 5.0 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 22 5.0 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 21 8.8 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 21 8.8 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 22.6 bits (46), Expect = 2.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 95 IIYNNGDRNFKR 130 IIYNN D +F+R Sbjct: 212 IIYNNSDNSFQR 223 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.8 bits (44), Expect = 5.0 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 95 IIYNNGDRNFKRCWFQTSRKNSVK 166 IIY N D +F R T NS K Sbjct: 212 IIYQNADDSFHRLSSHTLNHNSDK 235 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 21.8 bits (44), Expect = 5.0 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 95 IIYNNGDRNFKR 130 IIYNN D +F+R Sbjct: 211 IIYNNADDSFQR 222 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.8 bits (44), Expect = 5.0 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -1 Query: 277 FKVLPLASNLIACRSGYNEV 218 F LPL ++ R+G+NE+ Sbjct: 255 FTSLPLEDQVLLLRAGWNEL 274 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.8 bits (44), Expect = 5.0 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -1 Query: 277 FKVLPLASNLIACRSGYNEV 218 F LPL ++ R+G+NE+ Sbjct: 255 FTSLPLEDQVLLLRAGWNEL 274 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 21.0 bits (42), Expect = 8.8 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -1 Query: 358 QDICGPKSLTYSLYPFCMFKDFRVSSSFKV 269 Q +C PK LT+ L + K + + V Sbjct: 153 QPMCSPKLLTFDLKTSKLVKQVEIPHNIAV 182 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 21.0 bits (42), Expect = 8.8 Identities = 8/23 (34%), Positives = 10/23 (43%) Frame = +2 Query: 407 LGLPKALDSLWRTNFYSWSCSNC 475 LGLP L W+ + W C Sbjct: 85 LGLPFELSVFWQQYPWQWGLGIC 107 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,559 Number of Sequences: 438 Number of extensions: 3573 Number of successful extensions: 19 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16748661 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -