BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_P05 (354 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 25 0.30 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 22 2.1 DQ855500-1|ABH88187.1| 126|Tribolium castaneum chemosensory pro... 20 8.6 DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory pro... 20 8.6 DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped prot... 20 8.6 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 24.6 bits (51), Expect = 0.30 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 265 HPHDSCGHPPAAVPCCMPPSVALSADLTPT 354 HP+ + G PPA +P P + L+ +T T Sbjct: 177 HPYPNFGVPPAGIP-LQNPGLNLNPPVTQT 205 Score = 19.8 bits (39), Expect = 8.6 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +3 Query: 36 ASLIYHTNSNSLWLSF*SPPALLYSVYQLCH 128 A+ I+H + SL L + PP + Y H Sbjct: 147 AASIFHAAATSLPLHYPPPPPVYTHHYARYH 177 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 21.8 bits (44), Expect = 2.1 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = -1 Query: 342 VRRQSHRRGHTARYSSRGMP 283 ++R++H R T +++RG P Sbjct: 274 IQRRTHTRHTTTSHNTRGTP 293 >DQ855500-1|ABH88187.1| 126|Tribolium castaneum chemosensory protein 14 protein. Length = 126 Score = 19.8 bits (39), Expect = 8.6 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +1 Query: 82 SDRLLRSYTPCI 117 +DRL R+Y CI Sbjct: 36 NDRLTRNYIDCI 47 >DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory protein 4 protein. Length = 133 Score = 19.8 bits (39), Expect = 8.6 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = +1 Query: 82 SDRLLRSYTPCI 117 ++RLL+SY C+ Sbjct: 41 NERLLKSYVDCL 52 >DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped protein. Length = 126 Score = 19.8 bits (39), Expect = 8.6 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -1 Query: 351 GRKVRRQSHRRGH 313 G+ RRQ H R H Sbjct: 114 GKAFRRQDHLRDH 126 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,368 Number of Sequences: 336 Number of extensions: 1924 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 7087595 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -