BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_P04 (254 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0238 + 1854070-1854344,1854621-1854712,1854852-1855045,185... 27 2.1 02_05_0822 + 32025992-32026696,32027237-32027314,32027547-320277... 26 4.8 01_01_0827 + 6443319-6446085,6446317-6446407,6446502-6448017,644... 26 4.8 >03_01_0238 + 1854070-1854344,1854621-1854712,1854852-1855045, 1855529-1855568,1855734-1855815,1856972-1857049, 1857144-1857269,1857544-1857665,1858018-1858057, 1858250-1858324,1858414-1858585 Length = 431 Score = 27.1 bits (57), Expect = 2.1 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 161 GADKYTRLMLQKWWQR 208 GA KY RL Q WW+R Sbjct: 267 GAHKYGRLNEQSWWER 282 >02_05_0822 + 32025992-32026696,32027237-32027314,32027547-32027713, 32027811-32027885,32028624-32028742,32028908-32029204, 32029275-32029362,32029467-32029572,32029727-32029837, 32030520-32030683,32031237-32031357,32031958-32032182, 32032267-32032457,32032658-32032825,32032911-32033016, 32033301-32033438,32033533-32033697,32033777-32033980, 32034341-32034535,32034603-32034674,32034797-32034949 Length = 1215 Score = 25.8 bits (54), Expect = 4.8 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -1 Query: 239 SLAFVQASTGSVATISATLDEYIYLLLNSQGLTTAPAS*SCAI 111 SLA++QAS + +S L + L NS T + SC + Sbjct: 445 SLAYMQASAQYIKQVSGVLKVGVTTLRNSSSYETPQETYSCQL 487 >01_01_0827 + 6443319-6446085,6446317-6446407,6446502-6448017, 6448164-6448243,6449045-6449129,6449221-6449312, 6449388-6449456,6449544-6449580,6449662-6449744, 6450427-6450873,6450978-6451014,6451101-6451158, 6451243-6451382,6451610-6451675,6451794-6451908, 6453261-6453299,6453482-6453543 Length = 1927 Score = 25.8 bits (54), Expect = 4.8 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -3 Query: 204 CHHFCNIRRVYLSAP**PRPHHST 133 CHH N R+ + P P P H T Sbjct: 1653 CHHGMNNRQPIIEEPASPEPEHET 1676 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,763,815 Number of Sequences: 37544 Number of extensions: 90144 Number of successful extensions: 184 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 184 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 184 length of database: 14,793,348 effective HSP length: 63 effective length of database: 12,428,076 effective search space used: 260989596 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -