BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_P03 (543 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0582 + 17528335-17529790,17529913-17531651,17531814-175320... 28 5.5 01_06_0590 + 30453407-30455442,30456313-30456586,30456992-30457318 27 7.3 >04_03_0582 + 17528335-17529790,17529913-17531651,17531814-17532035, 17532062-17533525 Length = 1626 Score = 27.9 bits (59), Expect = 5.5 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 Query: 96 VPTNYGRTIQGILAYDKTNSGASANVTQGGL 188 V G Q +L YD+TN+GA + VT L Sbjct: 431 VAKGLGTVKQAVLEYDQTNTGAVSGVTPRAL 461 >01_06_0590 + 30453407-30455442,30456313-30456586,30456992-30457318 Length = 878 Score = 27.5 bits (58), Expect = 7.3 Identities = 13/44 (29%), Positives = 27/44 (61%) Frame = -2 Query: 158 SRIGLIVCEDTLNRSTVVSRYTRQRKIQILNSLLEYFRTVLYIV 27 SR+ L+ + TL T ++R + ++I+N+L + + V++IV Sbjct: 607 SRVILLDYDGTLVPQTTINRTPNESVVKIMNALCDDKKNVVFIV 650 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,178,618 Number of Sequences: 37544 Number of extensions: 191191 Number of successful extensions: 351 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 348 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 351 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1210221432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -