BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_P03 (543 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g20180.1 68414.m02522 hypothetical protein similar to At14a (... 28 4.6 At4g09190.1 68417.m01520 F-box family protein contains Pfam PF00... 27 6.1 >At1g20180.1 68414.m02522 hypothetical protein similar to At14a (GI:11994571 and GI:11994573) [Arabidopsis thaliana] Length = 391 Score = 27.9 bits (59), Expect = 4.6 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = -2 Query: 158 SRIGLIVCEDTLNRSTVVSRYTRQRKIQILNSLLEYF 48 SR+ +C++ +R TV + + RKI++L L F Sbjct: 314 SRLAGRLCDEIEHRKTVAAMCAKSRKIEVLKEALREF 350 >At4g09190.1 68417.m01520 F-box family protein contains Pfam PF00646: F-box domain; contains TIGRFAM TIGR01640 : F-box protein interaction domain; similar to Probable disease resistance RPP8-like protein 2 (Swiss-Prot:Q9MAG6) [Arabidopsis thaliana] Length = 383 Score = 27.5 bits (58), Expect = 6.1 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 78 YFSLPSVPTNYGRTIQGILAYDKTN 152 +F+LP + + GR + G L YD N Sbjct: 141 FFTLPKLDSKEGRPLTGFLGYDPIN 165 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,590,739 Number of Sequences: 28952 Number of extensions: 169580 Number of successful extensions: 315 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 312 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 315 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1013649368 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -