BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_P02 (543 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 24 0.99 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 22 3.0 DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory pro... 21 5.3 AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 21 7.0 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.8 bits (49), Expect = 0.99 Identities = 17/68 (25%), Positives = 27/68 (39%), Gaps = 2/68 (2%) Frame = +3 Query: 297 EKRKLTIPSSLGYGNRGAGNVIPPHATLHFEVELINIGDSPPTTNVFKEID--ADQNNML 470 EK+ PS+ + + PP T H++ + + PTT V + ID D Sbjct: 1154 EKKPGHKPSTSSWQKPTKPSYRPPSTTNHWQTKTTTSTTTRPTTTVSQLIDDKCDSGQYY 1213 Query: 471 SREEVSEY 494 E S + Sbjct: 1214 PHESCSSF 1221 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 22.2 bits (45), Expect = 3.0 Identities = 14/55 (25%), Positives = 23/55 (41%) Frame = -2 Query: 200 VELMTIAQSTRVVHGQHITIFRLRSTSFGHAQDINLKFGNLRICDRSSNKGQHHK 36 V L+ QS + H H+ + G + D N+K NL+ +G H+ Sbjct: 582 VVLVDEVQSPNLSHPFHLHGYAFNVVGIGRSPDQNVKKINLKHALDLDRRGLLHR 636 >DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory protein 10 protein. Length = 129 Score = 21.4 bits (43), Expect = 5.3 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +3 Query: 123 CTTKSKDGDMLTMHY 167 CT K K+G +HY Sbjct: 78 CTEKQKEGSRKIIHY 92 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 21.0 bits (42), Expect = 7.0 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -3 Query: 118 SGTLKTSILSSVTSESAIVAPTRANITKTQRNI 20 S +KT+ TSE + + N KTQ N+ Sbjct: 162 SERMKTTRALEKTSEELKIPKAKINTGKTQYNL 194 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,919 Number of Sequences: 336 Number of extensions: 2368 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13306679 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -