BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_P02 (543 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8342| Best HMM Match : FKBP_C (HMM E-Value=0) 180 9e-46 SB_19729| Best HMM Match : No HMM Matches (HMM E-Value=.) 128 4e-30 SB_53649| Best HMM Match : FKBP_C (HMM E-Value=4.1e-05) 35 0.037 SB_830| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_52570| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_4199| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_59669| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_28630| Best HMM Match : DUF1665 (HMM E-Value=3.4) 28 4.3 SB_55256| Best HMM Match : Lamp (HMM E-Value=0.55) 28 4.3 SB_27758| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28) 28 5.7 SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_20049| Best HMM Match : 7tm_1 (HMM E-Value=6.2e-05) 28 5.7 SB_1724| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_14606| Best HMM Match : efhand (HMM E-Value=0.00036) 27 7.5 SB_39508| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 27 7.5 SB_12811| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 >SB_8342| Best HMM Match : FKBP_C (HMM E-Value=0) Length = 266 Score = 180 bits (437), Expect = 9e-46 Identities = 92/173 (53%), Positives = 117/173 (67%), Gaps = 3/173 (1%) Frame = +3 Query: 33 VFVMLALVGATI-ADSEVTELKIDVLSVPEGCTTKSKDGDMLTMHYTGTLSDGHKFDSSF 209 + ++A G + A+ ELKI+V+S PE CT K+ GD L+MHYTG L++G+KFDSS Sbjct: 7 LLAIVAFSGLALGAEEPKGELKIEVVSKPEKCTRKTHVGDTLSMHYTGRLANGNKFDSSL 66 Query: 210 DRDQPFTFQLGVGQVIKGWDQGLRDMCVGEKRKLTIPSSLGYGNRGAGNVIPPHATLHFE 389 DR + F F LG G VI+GW+QGL DMC+GEKRKLTIP L YG GAG IPPHATL+ + Sbjct: 67 DRGKTFDFTLGKGMVIQGWEQGLLDMCIGEKRKLTIPPHLAYGENGAGAAIPPHATLYMD 126 Query: 390 VELINI-GDSPPTTNVFKEIDADQNNMLSREEVSEYLKKQ-WFPSDGPEMSED 542 VEL+ I G NVF ID + + +L++EEV YLK+Q PSD E S D Sbjct: 127 VELVEIQGSKESDPNVFGMIDKNNDKVLTQEEVKNYLKEQGGMPSD-DEASHD 178 >SB_19729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 128 bits (308), Expect = 4e-30 Identities = 61/147 (41%), Positives = 95/147 (64%), Gaps = 7/147 (4%) Frame = +3 Query: 87 ELKIDVLSVPEGCTTKSKDGDMLTMHYTGTLSDGHKFDSSFDRD---QPFTFQLGVGQVI 257 +++++ VP C K+K GD + +HYTG + DG FD++ D QPF F +G G VI Sbjct: 99 KIEVEETFVPSDCENKTKVGDHVVVHYTGWMQDGSLFDTTRDHRKGYQPFEFTIGGGTVI 158 Query: 258 KGWDQGLRDMCVGEKRKLTIPSSLGYGNRGA----GNVIPPHATLHFEVELINIGDSPPT 425 KG++QG+ MCVG+KRK+ IP +L YG +G+ GN+ + TL + +EL ++ PP Sbjct: 159 KGFEQGVTGMCVGQKRKIVIPPALAYGKKGSGDVPGNLDLTNTTLTYNLELFDVRKPPPH 218 Query: 426 TNVFKEIDADQNNMLSREEVSEYLKKQ 506 +++F +D + + LSREEVS Y++KQ Sbjct: 219 SDMFSHMDENGDRKLSREEVSAYMRKQ 245 >SB_53649| Best HMM Match : FKBP_C (HMM E-Value=4.1e-05) Length = 639 Score = 35.1 bits (77), Expect = 0.037 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 4/44 (9%) Frame = +3 Query: 144 GDMLTMHYTGTLSD----GHKFDSSFDRDQPFTFQLGVGQVIKG 263 GD + + YTG L + G FDS+ D+ F F+ G G+VIKG Sbjct: 122 GDAVEVKYTGWLLENGNFGKVFDSNAGTDKTFKFKTGKGKVIKG 165 >SB_830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1390 Score = 30.3 bits (65), Expect = 1.1 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Frame = +3 Query: 192 KFDSSF--DRDQPFTFQLGVGQVIKGWDQGLRDMCVGEKRKL-TIPSSLGYGNRG 347 K DS+F + +P +F +G GWD G G +KL T PS+ G N G Sbjct: 291 KLDSTFIWSKIRPMSFPCVLGMHEVGWDDGTFHSSTGAAQKLGTRPSNGGTKNSG 345 >SB_52570| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 28.7 bits (61), Expect = 3.2 Identities = 18/66 (27%), Positives = 33/66 (50%) Frame = -2 Query: 302 FLTYTHVSKSLIPAFDDLTDAELKGEWLIAIKTGVELMTIAQSTRVVHGQHITIFRLRST 123 + T ++ ++ +IP D LT +++ TG TI+ + R V H+T ++R+T Sbjct: 4 YQTNSYANRCVIP--DHLTRQQVRTTRPSHTPTGAYYQTISHANRCVLPDHLTRQQVRTT 61 Query: 122 SFGHAQ 105 H Q Sbjct: 62 RPSHTQ 67 >SB_4199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 28.7 bits (61), Expect = 3.2 Identities = 27/84 (32%), Positives = 37/84 (44%), Gaps = 6/84 (7%) Frame = +2 Query: 233 SARRRSSHQRLGSRTSRH-VCR*ET*TDHPFFLGLRQSRSRQCDPTSRHSSLRSRTNQH- 406 S S H+ TSRH R ET + H + R TSRH S R +T++H Sbjct: 37 SRHETSRHESSPHETSRHETSRHET-SRHERSRHETRQHERSRHKTSRHESSRHKTSRHG 95 Query: 407 --R*LTPDHQ--RVQGNRRGPKQH 466 R T H+ R + +R +QH Sbjct: 96 RSRHKTSRHETSRHERSRHETRQH 119 >SB_59669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3511 Score = 28.3 bits (60), Expect = 4.3 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -2 Query: 335 VAQGRRDGQFTFLTYTHVSKSLIPAFDDLTD 243 + +G +DG + FL H+S S +P D L + Sbjct: 3218 IKEGVKDGNWVFLANCHLSLSWMPQLDKLVE 3248 >SB_28630| Best HMM Match : DUF1665 (HMM E-Value=3.4) Length = 428 Score = 28.3 bits (60), Expect = 4.3 Identities = 23/66 (34%), Positives = 30/66 (45%) Frame = +2 Query: 212 SRSAIHLSARRRSSHQRLGSRTSRHVCR*ET*TDHPFFLGLRQSRSRQCDPTSRHSSLRS 391 SRS+ LS+RRRS H+R R + + SRSR R S RS Sbjct: 279 SRSS-SLSSRRRSKHKRKSKRDRSRSRDRSSSKSKSLRRSKKYSRSRSRSSERRRRS-RS 336 Query: 392 RTNQHR 409 R+ +HR Sbjct: 337 RSTEHR 342 >SB_55256| Best HMM Match : Lamp (HMM E-Value=0.55) Length = 284 Score = 28.3 bits (60), Expect = 4.3 Identities = 17/43 (39%), Positives = 23/43 (53%) Frame = -3 Query: 157 VSISPSLDFVVHPSGTLKTSILSSVTSESAIVAPTRANITKTQ 29 V+I PS +H S ++ S+ SSV S VAPT T T+ Sbjct: 48 VTIVPST-ISMHSSPSISVSVASSVMPSSTSVAPTTPPATTTK 89 >SB_27758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1926 Score = 28.3 bits (60), Expect = 4.3 Identities = 32/108 (29%), Positives = 44/108 (40%) Frame = +2 Query: 212 SRSAIHLSARRRSSHQRLGSRTSRHVCR*ET*TDHPFFLGLRQSRSRQCDPTSRHSSLRS 391 SRS LS+R RS R GSR + R + + +SRSR + S RS Sbjct: 638 SRSRTSLSSRSRS-RDRGGSRRGKRRSR--SRSSSYSSRSRSRSRSRDRGRGRKRSRRRS 694 Query: 392 RTNQHR*LTPDHQRVQGNRRGPKQHVVP*RSE*ISEEAMVSFRWSRDE 535 R++ H + R + RG + RS + S WS DE Sbjct: 695 RSSSHSSSSLSRSRSRSRSRGRGRRRSRSRSSSRKGKRQRSRSWSYDE 742 >SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28) Length = 440 Score = 27.9 bits (59), Expect = 5.7 Identities = 24/62 (38%), Positives = 33/62 (53%) Frame = +2 Query: 215 RSAIHLSARRRSSHQRLGSRTSRHVCR*ET*TDHPFFLGLRQSRSRQCDPTSRHSSLRSR 394 RS H S R RS H+R SR++ R +D F R+SRSR + + HS RSR Sbjct: 256 RSRYHRS-RSRSRHRR--SRSNSPSMRK---SDRKFKKSQRKSRSRSRNRSRSHSRKRSR 309 Query: 395 TN 400 ++ Sbjct: 310 SS 311 >SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 336 Score = 27.9 bits (59), Expect = 5.7 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +2 Query: 236 ARRRSSHQRLGSRTSRHVCR*ET*TDHPFFLGLRQSRSRQCDPTSRHSSLRSRTN-QHR 409 +R RS +R SR+ R R + + H +SRSR P RHS RS T+ +HR Sbjct: 226 SRSRSPRRRRRSRSPRRRRRSRSPSPHH---RSHRSRSRSRSPRRRHSRSRSPTHRRHR 281 >SB_20049| Best HMM Match : 7tm_1 (HMM E-Value=6.2e-05) Length = 1023 Score = 27.9 bits (59), Expect = 5.7 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +3 Query: 99 DVLSVPEGCTTKSKDGDML-TMHYTGTLSDGHKFDSSFDR 215 D VP GC + + DG++L + T + + H D +FDR Sbjct: 59 DEPGVPAGCNSTAFDGNILEAYNLTMNIFEKHFVDRTFDR 98 >SB_1724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 899 Score = 27.9 bits (59), Expect = 5.7 Identities = 17/64 (26%), Positives = 33/64 (51%) Frame = -2 Query: 302 FLTYTHVSKSLIPAFDDLTDAELKGEWLIAIKTGVELMTIAQSTRVVHGQHITIFRLRST 123 + T ++ ++ ++P D LT +++ TGV TI+ + R V H+T ++R+T Sbjct: 643 YQTISYANRCVLP--DHLTRQQVRTTRPSHTPTGVYYQTISHANRCVLPDHLTRQQVRTT 700 Query: 122 SFGH 111 H Sbjct: 701 RPSH 704 >SB_14606| Best HMM Match : efhand (HMM E-Value=0.00036) Length = 633 Score = 27.5 bits (58), Expect = 7.5 Identities = 11/35 (31%), Positives = 23/35 (65%) Frame = +3 Query: 435 FKEIDADQNNMLSREEVSEYLKKQWFPSDGPEMSE 539 F E+D ++++++SREE Y ++++ G EM + Sbjct: 576 FDEVDVNKDSLISREEFINYQQEKYKRLMGREMPD 610 >SB_39508| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1814 Score = 27.5 bits (58), Expect = 7.5 Identities = 10/37 (27%), Positives = 20/37 (54%) Frame = -3 Query: 541 SSLISGPSEGNHCFFRYSLTSSRDNMLFWSASISLNT 431 S L+SGPS N + T ++ +++W ++N+ Sbjct: 774 SPLLSGPSAANSATYPKYYTGNQTKLIYWHGEPAINS 810 >SB_12811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1254 Score = 27.1 bits (57), Expect = 9.9 Identities = 16/64 (25%), Positives = 32/64 (50%) Frame = -2 Query: 302 FLTYTHVSKSLIPAFDDLTDAELKGEWLIAIKTGVELMTIAQSTRVVHGQHITIFRLRST 123 + T +H ++ ++P D L +++ +TG TI+ + R V H+T ++R+T Sbjct: 664 YQTISHANRCVLP--DHLIRQQVRTTRPSNTQTGAYYQTISHANRCVLPDHLTRQQVRTT 721 Query: 122 SFGH 111 H Sbjct: 722 RPSH 725 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,988,769 Number of Sequences: 59808 Number of extensions: 349194 Number of successful extensions: 1037 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 912 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1028 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1239956166 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -