BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_P01 (562 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014298-2322|AAN09382.3| 16223|Drosophila melanogaster CG32580-... 28 7.5 BT023542-1|AAY84942.1| 305|Drosophila melanogaster IP09867p pro... 28 9.9 AE013599-4030|AAM68332.1| 305|Drosophila melanogaster CG30429-P... 28 9.9 >AE014298-2322|AAN09382.3| 16223|Drosophila melanogaster CG32580-PA protein. Length = 16223 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -1 Query: 250 TGRLRLDRYRCRPQCNFRTRTARILTSRS 164 T +L L R C +CNF+ T+ + TSRS Sbjct: 885 TCQLELGRDSCICECNFKESTSDVSTSRS 913 >BT023542-1|AAY84942.1| 305|Drosophila melanogaster IP09867p protein. Length = 305 Score = 27.9 bits (59), Expect = 9.9 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 64 GLVALTYVNGNKVKSYICQGYYGCEKCCVHLGSG 165 GL + Y NGN+ + + +GY E H+ +G Sbjct: 153 GLGVMFYANGNRYEGHFARGYKNGEGVFYHMHTG 186 >AE013599-4030|AAM68332.1| 305|Drosophila melanogaster CG30429-PA protein. Length = 305 Score = 27.9 bits (59), Expect = 9.9 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 64 GLVALTYVNGNKVKSYICQGYYGCEKCCVHLGSG 165 GL + Y NGN+ + + +GY E H+ +G Sbjct: 153 GLGVMFYANGNRYEGHFARGYKNGEGVFYHMHTG 186 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,271,739 Number of Sequences: 53049 Number of extensions: 433047 Number of successful extensions: 961 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 941 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 961 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2172596895 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -