BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_O22 (553 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10010| Best HMM Match : HLH (HMM E-Value=8.5e-09) 53 2e-07 SB_30776| Best HMM Match : HLH (HMM E-Value=1.7e-13) 44 1e-04 SB_40771| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_20446| Best HMM Match : HLH (HMM E-Value=1.26117e-44) 40 0.001 SB_9980| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_59476| Best HMM Match : HLH (HMM E-Value=1.2e-15) 35 0.038 SB_25662| Best HMM Match : HLH (HMM E-Value=2.3e-14) 35 0.051 SB_15721| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.067 SB_56922| Best HMM Match : HLH (HMM E-Value=1.9e-21) 34 0.089 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.12 SB_23535| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_38739| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.47 SB_27282| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.47 SB_5702| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_49233| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.83 SB_43750| Best HMM Match : NAP (HMM E-Value=3.3) 30 1.1 SB_44231| Best HMM Match : Ion_trans_2 (HMM E-Value=6.5e-09) 30 1.4 SB_22651| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_7044| Best HMM Match : PAN (HMM E-Value=1.3e-07) 30 1.4 SB_7690| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_1992| Best HMM Match : Geminin (HMM E-Value=0.0018) 29 1.9 SB_899| Best HMM Match : Alpha_L_fucos (HMM E-Value=0) 29 1.9 SB_54715| Best HMM Match : Hexapep (HMM E-Value=1.2e-05) 29 2.5 SB_41073| Best HMM Match : GRP (HMM E-Value=2.8) 29 2.5 SB_45809| Best HMM Match : Vicilin_N (HMM E-Value=4.5) 29 2.5 SB_38740| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_39750| Best HMM Match : Borrelia_orfA (HMM E-Value=1.1) 29 3.3 SB_39365| Best HMM Match : HLH (HMM E-Value=5.5e-07) 29 3.3 SB_36889| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.4 SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.4 SB_45371| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.4 SB_45151| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.4 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) 28 5.8 SB_28695| Best HMM Match : Ras (HMM E-Value=0) 28 5.8 SB_12754| Best HMM Match : Vicilin_N (HMM E-Value=0.49) 28 5.8 SB_53398| Best HMM Match : RVT_1 (HMM E-Value=7.8e-12) 27 7.7 SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_35674| Best HMM Match : SH2 (HMM E-Value=0) 27 7.7 SB_4905| Best HMM Match : Mito_carr (HMM E-Value=3.3e-13) 27 7.7 >SB_10010| Best HMM Match : HLH (HMM E-Value=8.5e-09) Length = 227 Score = 52.8 bits (121), Expect = 2e-07 Identities = 29/61 (47%), Positives = 37/61 (60%) Frame = +1 Query: 298 FKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 477 +KE RR +H AEQKRR IK G+D L +VPT +S K SKA VLQK+ + + Sbjct: 16 YKEHRRMSHISAEQKRRCNIKMGFDQLASMVPTLASQKSS--KVSKATVLQKNDNMVHLC 73 Query: 478 L 480 L Sbjct: 74 L 74 >SB_30776| Best HMM Match : HLH (HMM E-Value=1.7e-13) Length = 1217 Score = 43.6 bits (98), Expect = 1e-04 Identities = 27/80 (33%), Positives = 42/80 (52%) Frame = +1 Query: 232 SSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTD 411 S +N T S + ++ + RRR H + E++R+D I L E+VP C Sbjct: 112 SPTNNKTPYYISSDIVLSGGIAQQTRRRIVHNEVERRRKDKINNWITKLAEVVPDC---- 167 Query: 412 ASGYKHSKAAVLQKSIDYIQ 471 A G K SK VL+KS++Y++ Sbjct: 168 ARG-KQSKNIVLEKSVEYLK 186 >SB_40771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 553 Score = 41.5 bits (93), Expect = 4e-04 Identities = 23/84 (27%), Positives = 44/84 (52%), Gaps = 1/84 (1%) Frame = +1 Query: 226 TPSSSNQNTEDEDDSGDNKASAL-SFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQ 402 TP S+ + + + + ++ S S R+EAH + E+KRR+ I + + L+ ++P+C Sbjct: 452 TPRSTKRKRDSINSAVNHSTSKTPSTPAERKEAHLEKERKRRERIARSWFLLRSMIPSCS 511 Query: 403 QTDASGYKHSKAAVLQKSIDYIQY 474 T KA V + ++ YI + Sbjct: 512 DT------ADKATVFEMTVAYIHH 529 >SB_20446| Best HMM Match : HLH (HMM E-Value=1.26117e-44) Length = 424 Score = 40.3 bits (90), Expect = 0.001 Identities = 25/75 (33%), Positives = 39/75 (52%) Frame = +1 Query: 301 KERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLL 480 K RRE E++R +I G+ +L+ L+P + G K SKAA+LQ++ +YI + L Sbjct: 41 KRLRREIANSNERRRMQSINSGFQALRMLIP-----NTEGEKLSKAAILQQTSEYI-FTL 94 Query: 481 QQXXXXXXXXNALQK 525 +Q N K Sbjct: 95 EQDKTKLLQQNTTLK 109 Score = 40.3 bits (90), Expect = 0.001 Identities = 25/75 (33%), Positives = 39/75 (52%) Frame = +1 Query: 301 KERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLL 480 K RRE E++R +I G+ +L+ L+P + G K SKAA+LQ++ +YI + L Sbjct: 208 KRLRREIANSNERRRMQSINSGFQALRMLIP-----NTEGEKLSKAAILQQTSEYI-FTL 261 Query: 481 QQXXXXXXXXNALQK 525 +Q N K Sbjct: 262 EQDKTKLLQQNTTLK 276 >SB_9980| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 35.5 bits (78), Expect = 0.029 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = +1 Query: 286 SALSFKERRREAHTQAEQKRRDAIK 360 S+ S K+ RR AH+ AEQKRRDAIK Sbjct: 34 SSSSSKQNRRFAHSVAEQKRRDAIK 58 >SB_59476| Best HMM Match : HLH (HMM E-Value=1.2e-15) Length = 272 Score = 35.1 bits (77), Expect = 0.038 Identities = 18/56 (32%), Positives = 32/56 (57%) Frame = +1 Query: 310 RREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 477 R+ E+KRRD I + L+ LVPT + + S K KA +L +++++++L Sbjct: 12 RKRRRGLIEKKRRDRINRCLVELRRLVPTALEKEGSS-KLEKAEILHLTVEHLKWL 66 >SB_25662| Best HMM Match : HLH (HMM E-Value=2.3e-14) Length = 468 Score = 34.7 bits (76), Expect = 0.051 Identities = 18/55 (32%), Positives = 30/55 (54%) Frame = +1 Query: 307 RRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQ 471 RRR ++E++RRD + L +VP C +S K K VLQ +++Y++ Sbjct: 137 RRRTTRNESEKRRRDKLNVYITELAAMVPMCA---SSRKKLDKTTVLQMAVNYMK 188 >SB_15721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 34.3 bits (75), Expect = 0.067 Identities = 20/71 (28%), Positives = 38/71 (53%) Frame = +1 Query: 265 DSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAV 444 DSGD+K K ++ H++ E++RRD + + L ++P C +A K K V Sbjct: 172 DSGDSKGFQ---KGAIKQNHSEIEKRRRDKMNTYINELSTMIPMC---NAMSRKLDKLTV 225 Query: 445 LQKSIDYIQYL 477 L+ ++ +++ L Sbjct: 226 LRMAVQHMRAL 236 >SB_56922| Best HMM Match : HLH (HMM E-Value=1.9e-21) Length = 157 Score = 33.9 bits (74), Expect = 0.089 Identities = 22/85 (25%), Positives = 41/85 (48%), Gaps = 3/85 (3%) Frame = +1 Query: 235 SSNQNTEDEDDSGDNK---ASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQ 405 S +Q+T+D +D G + L+ ++R + E+KR + ++ L+ +P Sbjct: 4 SESQSTDDIEDQGATSELDSPELADTPKKRYTANRKERKRTQTMNTAFEDLRNHIPNVPP 63 Query: 406 TDASGYKHSKAAVLQKSIDYIQYLL 480 K SK L+ +I YI+YL+ Sbjct: 64 DT----KLSKIKTLRLAISYIRYLM 84 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 33.5 bits (73), Expect = 0.12 Identities = 16/55 (29%), Positives = 32/55 (58%) Frame = +1 Query: 313 REAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 477 RE H++ E++RR+ + + L ++VP+C K K VL+ +++Y++ L Sbjct: 14 RENHSEIERRRRNKMNAYINELSDMVPSC---TGLARKPDKLTVLRMAVNYMKTL 65 >SB_23535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 32.3 bits (70), Expect = 0.27 Identities = 26/89 (29%), Positives = 41/89 (46%), Gaps = 1/89 (1%) Frame = +1 Query: 223 QTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQ 402 Q + + TE E+D D K S ++RRRE I + + L+ LV Q Sbjct: 3 QDSAKDEKMTEAENDIDDRKWSKPVMEKRRRE-----------RINRSLEELKRLVLEAQ 51 Query: 403 QTDASGY-KHSKAAVLQKSIDYIQYLLQQ 486 D S Y K KA +L+ ++ +++ L Q Sbjct: 52 HRDCSRYTKLEKADILEMTVKHLRTLQSQ 80 >SB_38739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 31.5 bits (68), Expect = 0.47 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 1/70 (1%) Frame = +1 Query: 265 DSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKH-SKAA 441 DS D + LS +RR+ E+ RR I + L+ LV DAS Y KA Sbjct: 7 DSSDYVSKILS--DRRKAKKPMMEKLRRARINDSLNELKVLVLELLNKDASRYSKMEKAD 64 Query: 442 VLQKSIDYIQ 471 +L+ ++ Y++ Sbjct: 65 ILEMTVGYLR 74 >SB_27282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 644 Score = 31.5 bits (68), Expect = 0.47 Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = +1 Query: 226 TPSSS-NQNTEDEDDSGDNKASA 291 TPSSS N +T+D+DD DNK +A Sbjct: 494 TPSSSDNDDTQDDDDKSDNKPNA 516 Score = 27.9 bits (59), Expect = 5.8 Identities = 19/47 (40%), Positives = 24/47 (51%), Gaps = 3/47 (6%) Frame = +1 Query: 160 ITDICN--MYSRCGSSGSIQNIHQTPSSS-NQNTEDEDDSGDNKASA 291 I DIC+ R IQ PSSS N +T+D+DD D + SA Sbjct: 371 ILDICSEVFLIRNTREKGIQPSSDGPSSSDNDDTQDDDDKSDFQPSA 417 Score = 27.9 bits (59), Expect = 5.8 Identities = 12/23 (52%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = +1 Query: 226 TPSSSN-QNTEDEDDSGDNKASA 291 TPSSS+ +T+D+D+ DNK +A Sbjct: 560 TPSSSDGDDTQDDDEKSDNKPNA 582 >SB_5702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 31.1 bits (67), Expect = 0.63 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = +1 Query: 193 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQ 339 G S SI +Q P Q+ +D +D D+ A+ SF+ +AH A Q Sbjct: 2 GHSASIAKKYQAPK---QHVDDTNDEVDSLATVSSFRPTSPDAHNDARQ 47 >SB_49233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 309 Score = 30.7 bits (66), Expect = 0.83 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 199 SGSIQNIHQTPSSSNQNTEDEDDSGDNKA 285 SG+++ QTPS +N NT DSG A Sbjct: 4 SGALKEEQQTPSDTNNNTNGSSDSGGGGA 32 >SB_43750| Best HMM Match : NAP (HMM E-Value=3.3) Length = 514 Score = 30.3 bits (65), Expect = 1.1 Identities = 17/58 (29%), Positives = 31/58 (53%) Frame = +1 Query: 190 CGSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKK 363 CGSSG + + P+ + E+ + S + + +R+RE Q EQ+R+ A++K Sbjct: 437 CGSSGRKKRQAEMPAPVSTVQEETERSINMCPPGIWVCDRKRELKRQREQRRQAAMEK 494 >SB_44231| Best HMM Match : Ion_trans_2 (HMM E-Value=6.5e-09) Length = 441 Score = 29.9 bits (64), Expect = 1.4 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = +1 Query: 199 SGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDA 354 S +++ HQ +S+ + + D A+ K+RR E QA +KR +A Sbjct: 357 SSVVEDFHQNLTSTIERLRERHDQDMRNYIAILKKQRRNENKYQAYEKREEA 408 >SB_22651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 950 Score = 29.9 bits (64), Expect = 1.4 Identities = 18/72 (25%), Positives = 30/72 (41%) Frame = +1 Query: 220 HQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTC 399 ++ P + ED+DD + S K R+ + E K+ KK + +E Sbjct: 723 NKVPKVDKDDEEDDDDEEEESEEDESNKPSSRQVTAKKEDKKGKKKKKEEEEEEEEDQEE 782 Query: 400 QQTDASGYKHSK 435 + D+SG K K Sbjct: 783 EDEDSSGKKKGK 794 >SB_7044| Best HMM Match : PAN (HMM E-Value=1.3e-07) Length = 564 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -1 Query: 223 DGCFV*THCYHTESTCCIYQ*FIKLKT*NLIYCIKVRSIH 104 DG T C+H + CC Y+ I ++ + Y K+R +H Sbjct: 418 DGVAQRTVCFHLDGECCRYKTQIYVRRCHGFYVYKLRELH 457 >SB_7690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 430 Score = 29.9 bits (64), Expect = 1.4 Identities = 23/82 (28%), Positives = 39/82 (47%) Frame = +1 Query: 232 SSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTD 411 S S + E E+DS E R H E+KRR+ +K + L++ VP + + Sbjct: 332 SGSGDSDESENDS-----------EYTRATHNVLERKRRNDLKLKFQKLRDAVPELKDNE 380 Query: 412 ASGYKHSKAAVLQKSIDYIQYL 477 + K ++L+KS ++I L Sbjct: 381 ----RAPKVSILRKSWEHIVQL 398 >SB_1992| Best HMM Match : Geminin (HMM E-Value=0.0018) Length = 155 Score = 29.5 bits (63), Expect = 1.9 Identities = 21/66 (31%), Positives = 35/66 (53%), Gaps = 1/66 (1%) Frame = +1 Query: 196 SSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQ-AEQKRRDAIKKGYD 372 SS S SSS Q T+D+ S ++A AL +E E++ Q ++RR A+++ + Sbjct: 67 SSDSSDTESTKRSSSEQVTDDDKKSVSDEAFALMIQEPAPESYWQLLAEERRLALQETLE 126 Query: 373 SLQELV 390 Q +V Sbjct: 127 ENQRMV 132 >SB_899| Best HMM Match : Alpha_L_fucos (HMM E-Value=0) Length = 1127 Score = 29.5 bits (63), Expect = 1.9 Identities = 13/52 (25%), Positives = 27/52 (51%) Frame = +1 Query: 229 PSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQE 384 P + N+ D+DD D F+ + ++ ++ K+R + KKG++ Q+ Sbjct: 1038 PGAKNKKKHDDDDDDDEGGGDDKFEPKHKKKG-RSSSKKRHSRKKGHEEQQK 1088 >SB_54715| Best HMM Match : Hexapep (HMM E-Value=1.2e-05) Length = 1143 Score = 29.1 bits (62), Expect = 2.5 Identities = 17/54 (31%), Positives = 28/54 (51%) Frame = +1 Query: 223 QTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQE 384 +T S +T D D S D+ ++ S +ER + H + ++KR+ IKK E Sbjct: 745 ETKKSRKYSTTDSDCSSDDGENSDSSRERSIKKH-KKKKKRKKKIKKNRKKTME 797 >SB_41073| Best HMM Match : GRP (HMM E-Value=2.8) Length = 305 Score = 29.1 bits (62), Expect = 2.5 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +1 Query: 148 STL*ITDICNMYSRCGSSGSIQNIHQTPSSSNQNTEDEDDSGDN 279 S L + I +R G +G Q H+ ++N N D D+ DN Sbjct: 9 SDLLLAGILVAEARKGGNGYFQTTHRELDNNNDNDNDNDNDNDN 52 >SB_45809| Best HMM Match : Vicilin_N (HMM E-Value=4.5) Length = 215 Score = 29.1 bits (62), Expect = 2.5 Identities = 16/62 (25%), Positives = 34/62 (54%) Frame = +1 Query: 250 TEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKH 429 + D DD K S+ S K+R R + +++ ++RR + + DS + + +++ +S +H Sbjct: 5 SSDSDDDRRRKRSSKSSKKRDRRSRSRSRERRRRSKSRDRDS-RSRTSSRRRSRSSERRH 63 Query: 430 SK 435 K Sbjct: 64 RK 65 >SB_38740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 270 Score = 29.1 bits (62), Expect = 2.5 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = +1 Query: 304 ERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGY-KHSKAAVLQKSIDYIQ 471 +RRR E+ RR+ I L+ LV + D S Y + KA +L+ ++ YI+ Sbjct: 21 KRRRIMKPITERLRRERINSSLKELKFLVLSALGQDVSRYSRMEKADILEMTVSYIR 77 >SB_39750| Best HMM Match : Borrelia_orfA (HMM E-Value=1.1) Length = 810 Score = 28.7 bits (61), Expect = 3.3 Identities = 12/50 (24%), Positives = 24/50 (48%) Frame = +1 Query: 229 PSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSL 378 PSS + S NK S +SF + + E+++++ + K Y ++ Sbjct: 371 PSSKSHKKSSSKSSSSNKLSKISFLRKLMDGKILTEEQKKEELAKLYAAI 420 >SB_39365| Best HMM Match : HLH (HMM E-Value=5.5e-07) Length = 105 Score = 28.7 bits (61), Expect = 3.3 Identities = 17/51 (33%), Positives = 29/51 (56%) Frame = +1 Query: 334 EQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 ++KR AI++ + L L+P D K SK +LQ +I+YI+ L ++ Sbjct: 44 QRKREYAIREALNHLNSLLPL----DNPNRKLSKNMILQTAIEYIRSLQEE 90 >SB_36889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 28.3 bits (60), Expect = 4.4 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +2 Query: 212 KTSIKLRRLLIKIQKTKMTVEIIRHRHLVLKKGEEKLTPKQNRNEEMP 355 K +IKLRR+ +K +KT + V + + + EE L K R P Sbjct: 213 KDAIKLRRVPLKAEKTPLEVPLEVGTEVYIAVNEEDLQAKGRRRATDP 260 >SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 28.3 bits (60), Expect = 4.4 Identities = 18/67 (26%), Positives = 33/67 (49%), Gaps = 1/67 (1%) Frame = +1 Query: 232 SSSNQNTEDEDDSGD-NKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQT 408 SS + +D D +G+ +K+ + S + E + E+K+ KKG Q+ P ++ Sbjct: 184 SSDSDGEDDRDGNGEQSKSGSESDDDEEEEEEEEKEEKKLTQKKKGKTPEQKKTPGTKKA 243 Query: 409 DASGYKH 429 AS +H Sbjct: 244 -ASKQRH 249 >SB_45371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 28.3 bits (60), Expect = 4.4 Identities = 16/54 (29%), Positives = 31/54 (57%) Frame = +1 Query: 187 RCGSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRR 348 R G SG + ++ +SN T+ +DDS D K ++R+++ ++ E+KR+ Sbjct: 89 RWGHSG-YKELYPEEFASNF-TDSDDDSEDEKKKKKKTSKKRKKSSSKDERKRK 140 >SB_45151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 28.3 bits (60), Expect = 4.4 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -1 Query: 532 HILSEAHFVLPLDDAFAVVSIGYSLW 455 H +E HF P+D F +I Y LW Sbjct: 35 HTTAEGHFRFPMDVLFVDKTIKYKLW 60 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 27.9 bits (59), Expect = 5.8 Identities = 15/70 (21%), Positives = 30/70 (42%) Frame = +1 Query: 178 MYSRCGSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAI 357 M+ + SG + + ++ + Q E+E +K ++ + R + + K Sbjct: 387 MFEKISRSGELADSYEKKKAEMQKAEEETSFNYHKKKGIAAERREAKQEKEEADKYNKWN 446 Query: 358 KKGYDSLQEL 387 + DSLQEL Sbjct: 447 QDLVDSLQEL 456 >SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) Length = 736 Score = 27.9 bits (59), Expect = 5.8 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -1 Query: 223 DGCFV*TH-CYHTESTCCIYQ*FIKLK 146 DGC V CYH +CC + +IK++ Sbjct: 75 DGCLVTRKVCYHWSGSCCRWSNYIKVR 101 >SB_28695| Best HMM Match : Ras (HMM E-Value=0) Length = 1058 Score = 27.9 bits (59), Expect = 5.8 Identities = 11/29 (37%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Frame = +1 Query: 193 GSSGSIQNIHQT-PSSSNQNTEDEDDSGD 276 G +G N+H++ P ++N +D+DD+GD Sbjct: 783 GETGEEFNLHRSRPLIHDENDDDDDDNGD 811 >SB_12754| Best HMM Match : Vicilin_N (HMM E-Value=0.49) Length = 440 Score = 27.9 bits (59), Expect = 5.8 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 3/64 (4%) Frame = +1 Query: 220 HQTPSSSN--QNTEDEDDSGDNKASALSFKERRR-EAHTQAEQKRRDAIKKGYDSLQELV 390 HQ SS+ + +E + +NKA L + + + H + + + IKK D QELV Sbjct: 98 HQLRESSSKIEKLTEEKLTAENKAQGLQVELKTNLQRHEEKAKSLNEMIKKEIDKRQELV 157 Query: 391 PTCQ 402 Q Sbjct: 158 NEMQ 161 >SB_53398| Best HMM Match : RVT_1 (HMM E-Value=7.8e-12) Length = 924 Score = 27.5 bits (58), Expect = 7.7 Identities = 13/60 (21%), Positives = 32/60 (53%) Frame = +2 Query: 191 VVAVGLYKTSIKLRRLLIKIQKTKMTVEIIRHRHLVLKKGEEKLTPKQNRNEEMPLRKDM 370 ++A L + +++RL I++QK +TV + + + + + ++ NE+ L +D+ Sbjct: 626 IMAKPLSQAPCRIQRLPIRLQKYNITVRFVPGKEMFIADTLSRAFLIEDTNEQQDLNEDI 685 >SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1789 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/68 (23%), Positives = 30/68 (44%) Frame = +1 Query: 208 IQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQEL 387 +++ + SN++ +D+S D A + + E T AE K+ + DS + Sbjct: 1641 VEDDEKKADDSNEDIGKKDESRDQAEDAKKEESKTEEMETDAESKQEETGNATVDSTK-- 1698 Query: 388 VPTCQQTD 411 PT + D Sbjct: 1699 -PTAEAKD 1705 >SB_35674| Best HMM Match : SH2 (HMM E-Value=0) Length = 871 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/68 (23%), Positives = 30/68 (44%) Frame = +1 Query: 208 IQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQEL 387 +++ + SN++ +D+S D A + + E T AE K+ + DS + Sbjct: 220 VEDDEKKADDSNEDIGKKDESRDQAEDAKKEESKTEEMETDAESKQEETGNATVDSTK-- 277 Query: 388 VPTCQQTD 411 PT + D Sbjct: 278 -PTAEAKD 284 >SB_4905| Best HMM Match : Mito_carr (HMM E-Value=3.3e-13) Length = 577 Score = 27.5 bits (58), Expect = 7.7 Identities = 11/31 (35%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = -2 Query: 330 LGVSFSSPFFKTKCRCLIIS-TVIFVFCILI 241 LGV+++ F CR L++S T++ + C L+ Sbjct: 309 LGVTYAGKFTMAHCRALLVSLTILILPCYLV 339 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,004,681 Number of Sequences: 59808 Number of extensions: 323974 Number of successful extensions: 1628 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 1393 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1584 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1276425465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -