BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_O22 (553 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g00050.1 68417.m00005 basic helix-loop-helix (bHLH) family pr... 53 1e-07 At3g59060.2 68416.m06584 basic helix-loop-helix (bHLH) family pr... 53 1e-07 At3g59060.1 68416.m06583 basic helix-loop-helix (bHLH) family pr... 53 1e-07 At2g43010.2 68415.m05338 phytochrome-interacting factor 4 (PIF4)... 50 1e-06 At2g43010.1 68415.m05337 phytochrome-interacting factor 4 (PIF4)... 50 1e-06 At1g09530.2 68414.m01069 phytochrome interacting factor 3 (PIF3)... 48 4e-06 At1g09530.1 68414.m01068 phytochrome interacting factor 3 (PIF3)... 48 4e-06 At1g69010.1 68414.m07896 basic helix-loop-helix (bHLH) family pr... 47 1e-05 At2g46970.1 68415.m05867 basic helix-loop-helix (bHLH) protein, ... 46 1e-05 At2g20180.2 68415.m02360 basic helix-loop-helix (bHLH) family pr... 46 2e-05 At2g20180.1 68415.m02359 basic helix-loop-helix (bHLH) family pr... 46 2e-05 At3g23690.1 68416.m02979 basic helix-loop-helix (bHLH) family pr... 44 7e-05 At2g18300.2 68415.m02134 basic helix-loop-helix (bHLH) family pr... 44 7e-05 At2g18300.1 68415.m02133 basic helix-loop-helix (bHLH) family pr... 44 7e-05 At4g30980.1 68417.m04397 basic helix-loop-helix (bHLH) family pr... 44 9e-05 At1g26260.2 68414.m03204 basic helix-loop-helix (bHLH) family pr... 43 1e-04 At1g26260.1 68414.m03203 basic helix-loop-helix (bHLH) family pr... 43 1e-04 At4g36540.2 68417.m05189 basic helix-loop-helix (bHLH) family pr... 42 3e-04 At4g36540.1 68417.m05188 basic helix-loop-helix (bHLH) family pr... 42 3e-04 At4g36930.1 68417.m05235 basic helix-loop-helix (bHLH) protein S... 42 4e-04 At2g24260.1 68415.m02898 basic helix-loop-helix (bHLH) family pr... 41 5e-04 At1g10120.1 68414.m01141 basic helix-loop-helix (bHLH) family pr... 41 5e-04 At1g03040.1 68414.m00276 basic helix-loop-helix (bHLH) family pr... 41 6e-04 At5g61270.1 68418.m07689 basic helix-loop-helix (bHLH) family pr... 40 0.001 At4g28790.2 68417.m04116 basic helix-loop-helix (bHLH) family pr... 40 0.001 At4g28790.1 68417.m04117 basic helix-loop-helix (bHLH) family pr... 40 0.001 At4g02590.1 68417.m00353 basic helix-loop-helix (bHLH) family pr... 40 0.001 At5g38860.1 68418.m04700 basic helix-loop-helix (bHLH) family pr... 39 0.002 At1g68920.2 68414.m07888 basic helix-loop-helix (bHLH) family pr... 39 0.002 At1g68920.1 68414.m07887 basic helix-loop-helix (bHLH) family pr... 39 0.002 At5g58010.1 68418.m07258 basic helix-loop-helix (bHLH) family pr... 39 0.003 At4g28800.1 68417.m04118 bHLH family protein contains Pfam profi... 39 0.003 At4g27120.2 68417.m03898 expressed protein 39 0.003 At4g27120.1 68417.m03897 expressed protein 39 0.003 At5g08130.1 68418.m00948 basic helix-loop-helix (bHLH) family pr... 38 0.003 At3g07340.1 68416.m00875 basic helix-loop-helix (bHLH) family pr... 38 0.003 At4g37850.1 68417.m05354 basic helix-loop-helix (bHLH) family pr... 38 0.004 At4g34530.1 68417.m04907 basic helix-loop-helix (bHLH) family pr... 38 0.004 At1g02340.1 68414.m00180 long hypocotyl in far-red 1 (HFR1) / re... 38 0.006 At5g67110.1 68418.m08461 basic helix-loop-helix (bHLH) family pr... 37 0.008 At1g59640.2 68414.m06708 basic helix-loop-helix (bHLH) family pr... 37 0.008 At1g59640.1 68414.m06707 basic helix-loop-helix (bHLH) family pr... 37 0.008 At3g57800.2 68416.m06443 basic helix-loop-helix (bHLH) family pr... 37 0.010 At2g22750.1 68415.m02697 basic helix-loop-helix (bHLH) family pr... 37 0.010 At5g62610.1 68418.m07857 basic helix-loop-helix (bHLH) family pr... 36 0.014 At2g42300.1 68415.m05236 basic helix-loop-helix (bHLH) family pr... 36 0.018 At5g50915.2 68418.m06314 basic helix-loop-helix (bHLH) family pr... 35 0.042 At5g50915.1 68418.m06313 basic helix-loop-helix (bHLH) family pr... 35 0.042 At5g48560.1 68418.m06005 basic helix-loop-helix (bHLH) family pr... 35 0.042 At3g57800.1 68416.m06442 basic helix-loop-helix (bHLH) family pr... 34 0.055 At4g01720.1 68417.m00223 WRKY family transcription factor simila... 34 0.073 At4g17880.1 68417.m02665 basic helix-loop-helix (bHLH) family pr... 33 0.17 At1g76180.1 68414.m08846 dehydrin (ERD14) identical to SP|P42763... 33 0.17 At1g25330.1 68414.m03143 basic helix-loop-helix (bHLH) family pr... 33 0.17 At5g46760.1 68418.m05760 basic helix-loop-helix (bHLH) family pr... 32 0.29 At2g40200.1 68415.m04943 basic helix-loop-helix (bHLH) family pr... 32 0.29 At2g31210.1 68415.m03811 basic helix-loop-helix (bHLH) family pr... 31 0.39 At1g50410.1 68414.m05650 SNF2 domain-containing protein / helica... 31 0.39 At1g27740.1 68414.m03390 basic helix-loop-helix (bHLH) family pr... 31 0.39 At1g01260.1 68414.m00043 basic helix-loop-helix (bHLH) family pr... 31 0.39 At3g28770.1 68416.m03591 expressed protein 31 0.51 At3g20640.1 68416.m02612 ethylene-responsive protein -related co... 31 0.51 At1g61660.2 68414.m06950 basic helix-loop-helix (bHLH) family pr... 31 0.51 At1g61660.1 68414.m06949 basic helix-loop-helix (bHLH) family pr... 31 0.51 At1g25310.1 68414.m03141 basic helix-loop-helix (bHLH) family pr... 31 0.51 At1g22450.1 68414.m02806 cytochrome c oxidase subunit 6b, putati... 31 0.51 At5g41315.1 68418.m05021 basic helix-loop-helix (bHLH) family pr... 30 0.89 At5g37800.1 68418.m04552 basic helix-loop-helix (bHLH) family pr... 30 0.89 At4g29930.1 68417.m04258 basic helix-loop-helix (bHLH) family pr... 30 0.89 At4g00870.1 68417.m00118 basic helix-loop-helix (bHLH) family pr... 30 0.89 At3g19510.1 68416.m02472 homeobox protein (HAT 3.1) identical to... 30 0.89 At2g46510.1 68415.m05796 basic helix-loop-helix (bHLH) family pr... 30 0.89 At2g44200.1 68415.m05500 expressed protein 30 0.89 At2g14760.1 68415.m01667 basic helix-loop-helix protein / bHLH p... 30 0.89 At1g63650.2 68414.m07202 basic helix-loop-helix (bHLH) family pr... 30 0.89 At1g63650.1 68414.m07201 basic helix-loop-helix (bHLH) family pr... 30 0.89 At3g29075.1 68416.m03637 glycine-rich protein 29 1.6 At3g25710.1 68416.m03199 basic helix-loop-helix (bHLH) family pr... 29 1.6 At1g68810.1 68414.m07866 basic helix-loop-helix (bHLH) family pr... 29 1.6 At5g63720.1 68418.m07998 hypothetical protein 29 2.1 At5g43650.1 68418.m05335 basic helix-loop-helix (bHLH) family pr... 29 2.1 At4g38600.2 68417.m05463 HECT-domain-containing protein / ubiqui... 29 2.1 At4g38600.1 68417.m05464 HECT-domain-containing protein / ubiqui... 29 2.1 At2g45130.1 68415.m05616 SPX (SYG1/Pho81/XPR1) domain-containing... 29 2.1 At1g66470.1 68414.m07551 basic helix-loop-helix (bHLH) family pr... 29 2.1 At1g12860.1 68414.m01494 basic helix-loop-helix (bHLH) family pr... 29 2.1 At4g16430.1 68417.m02487 basic helix-loop-helix (bHLH) family pr... 29 2.7 At3g30725.1 68416.m03909 expressed protein ; expression supporte... 29 2.7 At2g22770.1 68415.m02701 basic helix-loop-helix (bHLH) family pr... 29 2.7 At2g20310.1 68415.m02372 expressed protein 29 2.7 At2g06210.2 68415.m00683 phosphoprotein-related low similarity t... 29 2.7 At2g06210.1 68415.m00684 phosphoprotein-related low similarity t... 29 2.7 At4g09820.1 68417.m01611 basic helix-loop-helix (bHLH) family pr... 28 3.6 At3g30775.1 68416.m03933 proline oxidase, mitochondrial / osmoti... 28 3.6 At2g31730.1 68415.m03874 ethylene-responsive protein, putative s... 28 3.6 At2g28160.1 68415.m03420 basic helix-loop-helix (bHLH) family pr... 28 3.6 At2g02480.1 68415.m00187 DNA polymerase-related weak similarity ... 28 3.6 At1g32640.1 68414.m04026 basic helix-loop-helix (bHLH) protein (... 28 3.6 At5g16500.1 68418.m01928 protein kinase family protein contains ... 28 4.8 At3g21480.1 68416.m02710 transcription activation domain-interac... 28 4.8 At1g17820.1 68414.m02206 expressed protein 28 4.8 At5g41090.1 68418.m04995 no apical meristem (NAM) family protein... 27 6.3 At4g33880.1 68417.m04807 basic helix-loop-helix (bHLH) family pr... 27 6.3 At4g04890.1 68417.m00712 homeobox-leucine zipper protein protode... 27 6.3 At3g14010.1 68416.m01769 hydroxyproline-rich glycoprotein family... 27 6.3 At2g41130.1 68415.m05080 basic helix-loop-helix (bHLH) family pr... 27 6.3 At2g03810.2 68415.m00341 18S pre-ribosomal assembly protein gar2... 27 6.3 At2g03810.1 68415.m00340 18S pre-ribosomal assembly protein gar2... 27 6.3 At1g77500.1 68414.m09025 expressed protein contains Pfam domains... 27 6.3 At1g57680.2 68414.m06546 expressed protein 27 6.3 At1g57680.1 68414.m06545 expressed protein 27 6.3 At1g52160.1 68414.m05887 metallo-beta-lactamase family protein 27 6.3 At1g30670.1 68414.m03750 basic helix-loop-helix (bHLH) family pr... 27 6.3 At1g14687.1 68414.m01755 zinc finger homeobox family protein / Z... 27 6.3 At1g10610.1 68414.m01202 basic helix-loop-helix (bHLH) family pr... 27 6.3 At5g56960.1 68418.m07110 basic helix-loop-helix (bHLH) family pr... 27 8.3 At4g29550.1 68417.m04214 expressed protein contains Pfam profile... 27 8.3 At4g27290.1 68417.m03916 S-locus protein kinase, putative simila... 27 8.3 At3g29763.1 68416.m03760 hypothetical protein 27 8.3 At2g16910.1 68415.m01948 basic helix-loop-helix (bHLH) family pr... 27 8.3 At1g29570.1 68414.m03616 zinc finger protein-related contains si... 27 8.3 At1g19260.1 68414.m02396 hAT dimerisation domain-containing prot... 27 8.3 >At4g00050.1 68417.m00005 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 399 Score = 52.8 bits (121), Expect = 1e-07 Identities = 34/99 (34%), Positives = 53/99 (53%), Gaps = 1/99 (1%) Frame = +1 Query: 193 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREA-HTQAEQKRRDAIKKGY 369 GS + + H + S EDE++ S++S K R A H Q+E+KRRD I + Sbjct: 174 GSHDNTIDDHDSVCHSRPQMEDEEEKKAGGKSSVSTKRSRAAAIHNQSERKRRDKINQRM 233 Query: 370 DSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 +LQ+LVP +TD KA++L + I+Y++ L Q Sbjct: 234 KTLQKLVPNSSKTD-------KASMLDEVIEYLKQLQAQ 265 >At3g59060.2 68416.m06584 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 444 Score = 52.8 bits (121), Expect = 1e-07 Identities = 31/82 (37%), Positives = 47/82 (57%), Gaps = 3/82 (3%) Frame = +1 Query: 250 TEDEDDSGDNKASALSFKERRR---EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASG 420 T +D + NK+S S RR E H +E++RRD I + +LQEL+P C +TD Sbjct: 234 TSTDDQTMGNKSSQRSGSTRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSRTD--- 290 Query: 421 YKHSKAAVLQKSIDYIQYLLQQ 486 KA++L ++IDY++ L Q Sbjct: 291 ----KASILDEAIDYLKSLQMQ 308 >At3g59060.1 68416.m06583 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 442 Score = 52.8 bits (121), Expect = 1e-07 Identities = 31/82 (37%), Positives = 47/82 (57%), Gaps = 3/82 (3%) Frame = +1 Query: 250 TEDEDDSGDNKASALSFKERRR---EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASG 420 T +D + NK+S S RR E H +E++RRD I + +LQEL+P C +TD Sbjct: 234 TSTDDQTMGNKSSQRSGSTRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSRTD--- 290 Query: 421 YKHSKAAVLQKSIDYIQYLLQQ 486 KA++L ++IDY++ L Q Sbjct: 291 ----KASILDEAIDYLKSLQMQ 308 >At2g43010.2 68415.m05338 phytochrome-interacting factor 4 (PIF4) / basic helix-loop-helix protein 9 (bHLH9) / short under red-light 2 (SRL2) identical to SP|Q8W2F3 Phytochrome-interacting factor 4 (Basic helix-loop-helix protein 9) (bHLH9) (Short under red-light 2) {Arabidopsis thaliana}; supporting cDNA gi|18026965|gb|AF251694.1|AF251694 Length = 428 Score = 50.0 bits (114), Expect = 1e-06 Identities = 26/70 (37%), Positives = 42/70 (60%) Frame = +1 Query: 277 NKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKS 456 N+ S + + R E H +E++RRD I + +LQEL+P C +TD KA++L ++ Sbjct: 247 NQRSGSNRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSKTD-------KASILDEA 299 Query: 457 IDYIQYLLQQ 486 IDY++ L Q Sbjct: 300 IDYLKSLQLQ 309 >At2g43010.1 68415.m05337 phytochrome-interacting factor 4 (PIF4) / basic helix-loop-helix protein 9 (bHLH9) / short under red-light 2 (SRL2) identical to SP|Q8W2F3 Phytochrome-interacting factor 4 (Basic helix-loop-helix protein 9) (bHLH9) (Short under red-light 2) {Arabidopsis thaliana}; supporting cDNA gi|18026965|gb|AF251694.1|AF251694 Length = 430 Score = 50.0 bits (114), Expect = 1e-06 Identities = 26/70 (37%), Positives = 42/70 (60%) Frame = +1 Query: 277 NKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKS 456 N+ S + + R E H +E++RRD I + +LQEL+P C +TD KA++L ++ Sbjct: 247 NQRSGSNRRSRAAEVHNLSERRRRDRINERMKALQELIPHCSKTD-------KASILDEA 299 Query: 457 IDYIQYLLQQ 486 IDY++ L Q Sbjct: 300 IDYLKSLQLQ 309 >At1g09530.2 68414.m01069 phytochrome interacting factor 3 (PIF3) identical to phytochrome interacting factor 3 (PIF3) GI:3929585 from [Arabidopsis thaliana] Length = 524 Score = 48.0 bits (109), Expect = 4e-06 Identities = 32/102 (31%), Positives = 55/102 (53%), Gaps = 8/102 (7%) Frame = +1 Query: 205 SIQNIHQTPSSSNQNTED-EDDSGDNKASAL-------SFKERRREAHTQAEQKRRDAIK 360 S++ H + ++ED E++SGD + A S + R E H +E++RRD I Sbjct: 301 SLKRKHSNIQDIDCHSEDVEEESGDGRKEAGPSRTGLGSKRSRSAEVHNLSERRRRDRIN 360 Query: 361 KGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 + +LQEL+P C + D KA++L ++I+Y++ L Q Sbjct: 361 EKMRALQELIPNCNKVD-------KASMLDEAIEYLKSLQLQ 395 >At1g09530.1 68414.m01068 phytochrome interacting factor 3 (PIF3) identical to phytochrome interacting factor 3 (PIF3) GI:3929585 from [Arabidopsis thaliana] Length = 524 Score = 48.0 bits (109), Expect = 4e-06 Identities = 32/102 (31%), Positives = 55/102 (53%), Gaps = 8/102 (7%) Frame = +1 Query: 205 SIQNIHQTPSSSNQNTED-EDDSGDNKASAL-------SFKERRREAHTQAEQKRRDAIK 360 S++ H + ++ED E++SGD + A S + R E H +E++RRD I Sbjct: 301 SLKRKHSNIQDIDCHSEDVEEESGDGRKEAGPSRTGLGSKRSRSAEVHNLSERRRRDRIN 360 Query: 361 KGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 + +LQEL+P C + D KA++L ++I+Y++ L Q Sbjct: 361 EKMRALQELIPNCNKVD-------KASMLDEAIEYLKSLQLQ 395 >At1g69010.1 68414.m07896 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 311 Score = 46.8 bits (106), Expect = 1e-05 Identities = 29/86 (33%), Positives = 46/86 (53%) Frame = +1 Query: 229 PSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQT 408 PSS+ + D ++KASA+ R H+ EQ+RR I + + L+EL+P +Q Sbjct: 25 PSSNTTVHSNRDSKENDKASAI------RSKHSVTEQRRRSKINERFQILRELIPNSEQ- 77 Query: 409 DASGYKHSKAAVLQKSIDYIQYLLQQ 486 K A+ L + IDY+QYL ++ Sbjct: 78 -----KRDTASFLLEVIDYVQYLQEK 98 >At2g46970.1 68415.m05867 basic helix-loop-helix (bHLH) protein, putative similar to PIF3 like basic Helix Loop Helix protein (PIL1) [Arabidopsis thaliana] GI:22535492; contains Myc-type, 'helix-loop-helix' dimerization domain signature, PROSITE:PS00038 Length = 416 Score = 46.4 bits (105), Expect = 1e-05 Identities = 31/98 (31%), Positives = 49/98 (50%), Gaps = 3/98 (3%) Frame = +1 Query: 202 GSIQNIHQTPSSSNQNTEDEDDSGDNKASA---LSFKERRREAHTQAEQKRRDAIKKGYD 372 G I+ T S+N + E +D A ++ ++R E H E+KRRD K Sbjct: 191 GDIEEEESTYLSNNSDDESDDAKTQVHARTRKPVTKRKRSTEVHKLYERKRRDEFNKKMR 250 Query: 373 SLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 +LQ+L+P C YK KA++L ++I Y++ L Q Sbjct: 251 ALQDLLPNC-------YKDDKASLLDEAIKYMRTLQLQ 281 >At2g20180.2 68415.m02360 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 478 Score = 46.0 bits (104), Expect = 2e-05 Identities = 26/86 (30%), Positives = 49/86 (56%), Gaps = 1/86 (1%) Frame = +1 Query: 232 SSSNQNTEDEDDSGDNKASALSFKERRR-EAHTQAEQKRRDAIKKGYDSLQELVPTCQQT 408 +++++ +++ + S S K R E H +E+KRRD I + +LQEL+P C ++ Sbjct: 258 TTTDETESRSEETKQARVSTTSTKRSRAAEVHNLSERKRRDRINERMKALQELIPRCNKS 317 Query: 409 DASGYKHSKAAVLQKSIDYIQYLLQQ 486 D KA++L ++I+Y++ L Q Sbjct: 318 D-------KASMLDEAIEYMKSLQLQ 336 >At2g20180.1 68415.m02359 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 407 Score = 46.0 bits (104), Expect = 2e-05 Identities = 26/86 (30%), Positives = 49/86 (56%), Gaps = 1/86 (1%) Frame = +1 Query: 232 SSSNQNTEDEDDSGDNKASALSFKERRR-EAHTQAEQKRRDAIKKGYDSLQELVPTCQQT 408 +++++ +++ + S S K R E H +E+KRRD I + +LQEL+P C ++ Sbjct: 187 TTTDETESRSEETKQARVSTTSTKRSRAAEVHNLSERKRRDRINERMKALQELIPRCNKS 246 Query: 409 DASGYKHSKAAVLQKSIDYIQYLLQQ 486 D KA++L ++I+Y++ L Q Sbjct: 247 D-------KASMLDEAIEYMKSLQLQ 265 >At3g23690.1 68416.m02979 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 371 Score = 44.0 bits (99), Expect = 7e-05 Identities = 35/110 (31%), Positives = 51/110 (46%), Gaps = 12/110 (10%) Frame = +1 Query: 193 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASA---------LSFKERRREA---HTQAE 336 GS G ++ SS E D GDNK A + + RR +A H+ AE Sbjct: 147 GSKGGKRSKQDVAGSSKNGVEKCDSKGDNKDDAKPPEAPKDYIHVRARRGQATDSHSLAE 206 Query: 337 QKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 + RR+ I + LQ+LVP C + KA +L + I+Y+Q L +Q Sbjct: 207 RARREKISERMTLLQDLVPGCNRIT------GKAVMLDEIINYVQSLQRQ 250 >At2g18300.2 68415.m02134 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain ;supported by cDNA gi|20127067|gb|AF488597.1| Length = 337 Score = 44.0 bits (99), Expect = 7e-05 Identities = 30/95 (31%), Positives = 50/95 (52%), Gaps = 4/95 (4%) Frame = +1 Query: 214 NIHQTPSSSNQNTEDEDDSGDN-KASALSFKERRREA---HTQAEQKRRDAIKKGYDSLQ 381 N+ T +SS+ + E + +N K + + RR +A H+ AE+ RR+ I K LQ Sbjct: 156 NMGNTEASSDTSKETSKGASENQKLDYIHVRARRGQATDRHSLAERARREKISKKMKYLQ 215 Query: 382 ELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 ++VP C + KA +L + I+Y+Q L +Q Sbjct: 216 DIVPGCNKVT------GKAGMLDEIINYVQCLQRQ 244 >At2g18300.1 68415.m02133 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain ;supported by cDNA gi|20127067|gb|AF488597.1| Length = 335 Score = 44.0 bits (99), Expect = 7e-05 Identities = 30/95 (31%), Positives = 50/95 (52%), Gaps = 4/95 (4%) Frame = +1 Query: 214 NIHQTPSSSNQNTEDEDDSGDN-KASALSFKERRREA---HTQAEQKRRDAIKKGYDSLQ 381 N+ T +SS+ + E + +N K + + RR +A H+ AE+ RR+ I K LQ Sbjct: 156 NMGNTEASSDTSKETSKGASENQKLDYIHVRARRGQATDRHSLAERARREKISKKMKYLQ 215 Query: 382 ELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 ++VP C + KA +L + I+Y+Q L +Q Sbjct: 216 DIVPGCNKVT------GKAGMLDEIINYVQCLQRQ 244 >At4g30980.1 68417.m04397 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 310 Score = 43.6 bits (98), Expect = 9e-05 Identities = 30/98 (30%), Positives = 50/98 (51%) Frame = +1 Query: 193 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYD 372 GS G Q Q+ ++++ T K + + + + H+ AE+ RR+ I + Sbjct: 100 GSGGQTQT--QSQATASATTGGATAQPQTKPKVRARRGQATDPHSIAERLRRERIAERMK 157 Query: 373 SLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 SLQELVP +TD KA++L + IDY+++L Q Sbjct: 158 SLQELVPNGNKTD-------KASMLDEIIDYVKFLQLQ 188 >At1g26260.2 68414.m03204 basic helix-loop-helix (bHLH) family protein similar to bHLH transcription factor GBOF-1 GI:5923912 from [Tulipa gesneriana] Length = 390 Score = 43.2 bits (97), Expect = 1e-04 Identities = 30/93 (32%), Positives = 47/93 (50%), Gaps = 4/93 (4%) Frame = +1 Query: 211 QNIHQTPSSSNQNTEDEDDSGDN-KASALSFKERRREA---HTQAEQKRRDAIKKGYDSL 378 Q Q+P+S+ T E D+ K + + RR +A H+ AE+ RR+ I + L Sbjct: 193 QKDEQSPTSNANKTNSEKQPSDSLKDGYIHMRARRGQATNSHSLAERVRREKISERMKFL 252 Query: 379 QELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 477 Q+LVP C + KA +L + I+Y+Q L Sbjct: 253 QDLVPGCDKVT------GKAVMLDEIINYVQSL 279 >At1g26260.1 68414.m03203 basic helix-loop-helix (bHLH) family protein similar to bHLH transcription factor GBOF-1 GI:5923912 from [Tulipa gesneriana] Length = 390 Score = 43.2 bits (97), Expect = 1e-04 Identities = 30/93 (32%), Positives = 47/93 (50%), Gaps = 4/93 (4%) Frame = +1 Query: 211 QNIHQTPSSSNQNTEDEDDSGDN-KASALSFKERRREA---HTQAEQKRRDAIKKGYDSL 378 Q Q+P+S+ T E D+ K + + RR +A H+ AE+ RR+ I + L Sbjct: 193 QKDEQSPTSNANKTNSEKQPSDSLKDGYIHMRARRGQATNSHSLAERVRREKISERMKFL 252 Query: 379 QELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 477 Q+LVP C + KA +L + I+Y+Q L Sbjct: 253 QDLVPGCDKVT------GKAVMLDEIINYVQSL 279 >At4g36540.2 68417.m05189 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 302 Score = 41.9 bits (94), Expect = 3e-04 Identities = 30/87 (34%), Positives = 44/87 (50%), Gaps = 3/87 (3%) Frame = +1 Query: 235 SSNQNTEDEDDSGDNKASALSFKERRREA---HTQAEQKRRDAIKKGYDSLQELVPTCQQ 405 S+ NTE + K + + RR EA H+ AE+ RR+ I K LQ++VP C + Sbjct: 122 SNMSNTETSSEI--QKPDYIHVRARRGEATDRHSLAERARREKISKKMKCLQDIVPGCNK 179 Query: 406 TDASGYKHSKAAVLQKSIDYIQYLLQQ 486 KA +L + I+Y+Q L QQ Sbjct: 180 VT------GKAGMLDEIINYVQSLQQQ 200 >At4g36540.1 68417.m05188 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 304 Score = 41.9 bits (94), Expect = 3e-04 Identities = 30/87 (34%), Positives = 44/87 (50%), Gaps = 3/87 (3%) Frame = +1 Query: 235 SSNQNTEDEDDSGDNKASALSFKERRREA---HTQAEQKRRDAIKKGYDSLQELVPTCQQ 405 S+ NTE + K + + RR EA H+ AE+ RR+ I K LQ++VP C + Sbjct: 122 SNMSNTETSSEI--QKPDYIHVRARRGEATDRHSLAERARREKISKKMKCLQDIVPGCNK 179 Query: 406 TDASGYKHSKAAVLQKSIDYIQYLLQQ 486 KA +L + I+Y+Q L QQ Sbjct: 180 VT------GKAGMLDEIINYVQSLQQQ 200 >At4g36930.1 68417.m05235 basic helix-loop-helix (bHLH) protein SPATULA (SPT) identical to SPATULA (SPT) GI:11245493 from [Arabidopsis thaliana] Length = 373 Score = 41.5 bits (93), Expect = 4e-04 Identities = 31/104 (29%), Positives = 53/104 (50%), Gaps = 3/104 (2%) Frame = +1 Query: 184 SRCGSSGSIQNIHQTPSSSN-QNTEDEDDSGDNKASALSFKERRR--EAHTQAEQKRRDA 354 S G+SG+ + + S + DE S + S+ S +R R E H +E++RR Sbjct: 153 SSVGASGNETDEYDCESEEGGEAVVDEAPSSKSGPSSRSSSKRCRAAEVHNLSEKRRRSR 212 Query: 355 IKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 I + +LQ L+P +TD KA++L ++I+Y++ L Q Sbjct: 213 INEKMKALQSLIPNSNKTD-------KASMLDEAIEYLKQLQLQ 249 >At2g24260.1 68415.m02898 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 350 Score = 41.1 bits (92), Expect = 5e-04 Identities = 34/106 (32%), Positives = 52/106 (49%), Gaps = 8/106 (7%) Frame = +1 Query: 193 GSSGSIQNIH-QTPSSSNQNTEDEDDSGDNKA----SALSFKERRREA---HTQAEQKRR 348 GS G + N QT + + +G A S + RR +A H+ AE+ RR Sbjct: 98 GSGGGLMNQQGQTQTQTQPQASASTATGGTVAAPPQSRTKIRARRGQATDPHSIAERLRR 157 Query: 349 DAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 + I + +LQELVP +TD KA++L + IDY+++L Q Sbjct: 158 ERIAERMKALQELVPNGNKTD-------KASMLDEIIDYVKFLQLQ 196 >At1g10120.1 68414.m01141 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 301 Score = 41.1 bits (92), Expect = 5e-04 Identities = 31/101 (30%), Positives = 46/101 (45%), Gaps = 3/101 (2%) Frame = +1 Query: 193 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREA---HTQAEQKRRDAIKK 363 G+ S + S N E K + + + RR +A H+ AE+ RR+ I + Sbjct: 106 GNDQSQKKHKNDQSKETVNKESSQSEEAPKENYIHMRARRGQATNSHSLAERVRREKISE 165 Query: 364 GYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 LQELVP C + KA +L + I+Y+Q L QQ Sbjct: 166 RMRLLQELVPGCNKIT------GKAVMLDEIINYVQSLQQQ 200 >At1g03040.1 68414.m00276 basic helix-loop-helix (bHLH) family protein component of the pyruvate dehydrogenase complex E3, contains PF|00010 helix-loop-helix DNA-binding domain. ESTs gb|T45640 and gb|T22783 come from this gene Length = 302 Score = 40.7 bits (91), Expect = 6e-04 Identities = 22/57 (38%), Positives = 36/57 (63%) Frame = +1 Query: 316 EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 + H+ AE+ RR+ I + SLQELVPT +TD +AA++ + +DY+++L Q Sbjct: 153 DPHSIAERLRRERIAERIRSLQELVPTVNKTD-------RAAMIDEIVDYVKFLRLQ 202 >At5g61270.1 68418.m07689 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 366 Score = 39.9 bits (89), Expect = 0.001 Identities = 26/98 (26%), Positives = 48/98 (48%), Gaps = 1/98 (1%) Frame = +1 Query: 235 SSNQNTEDEDDSGDNKASALSFKERRREA-HTQAEQKRRDAIKKGYDSLQELVPTCQQTD 411 S Q+TE ++ +A + + R A H ++E++RRD I + +LQ+L+PT + D Sbjct: 141 SETQDTEGDEQETRGEAGRSNGRRGRAAAIHNESERRRRDRINQRMRTLQKLLPTASKAD 200 Query: 412 ASGYKHSKAAVLQKSIDYIQYLLQQXXXXXXXXNALQK 525 K ++L I++++ L Q N Q+ Sbjct: 201 -------KVSILDDVIEHLKQLQAQVQFMSLRANLPQQ 231 >At4g28790.2 68417.m04116 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 340 Score = 39.9 bits (89), Expect = 0.001 Identities = 27/82 (32%), Positives = 43/82 (52%) Frame = +1 Query: 241 NQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASG 420 NQ TE+ DS +K S R H +E++RR I + +LQEL+P C +TD Sbjct: 261 NQGTEEARDSTSSKRS------RAAIMHKLSERRRRQKINEMMKALQELLPRCTKTD--- 311 Query: 421 YKHSKAAVLQKSIDYIQYLLQQ 486 ++++L I+Y++ L Q Sbjct: 312 ----RSSMLDDVIEYVKSLQSQ 329 >At4g28790.1 68417.m04117 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 413 Score = 39.9 bits (89), Expect = 0.001 Identities = 27/82 (32%), Positives = 43/82 (52%) Frame = +1 Query: 241 NQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASG 420 NQ TE+ DS +K S R H +E++RR I + +LQEL+P C +TD Sbjct: 261 NQGTEEARDSTSSKRS------RAAIMHKLSERRRRQKINEMMKALQELLPRCTKTD--- 311 Query: 421 YKHSKAAVLQKSIDYIQYLLQQ 486 ++++L I+Y++ L Q Sbjct: 312 ----RSSMLDDVIEYVKSLQSQ 329 >At4g02590.1 68417.m00353 basic helix-loop-helix (bHLH) family protein similar to A. thaliana putative protein F6I18.110, GenBank accession number 2980768 Length = 310 Score = 39.5 bits (88), Expect = 0.001 Identities = 21/57 (36%), Positives = 36/57 (63%) Frame = +1 Query: 316 EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 + H+ AE+ RR+ I + +LQELVPT +TD +AA++ + +DY+++L Q Sbjct: 155 DPHSIAERLRRERIAERIRALQELVPTVNKTD-------RAAMIDEIVDYVKFLRLQ 204 >At5g38860.1 68418.m04700 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 298 Score = 39.1 bits (87), Expect = 0.002 Identities = 19/58 (32%), Positives = 34/58 (58%) Frame = +1 Query: 313 REAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 R H++ EQ+RR I + + SL +++P Q + K KA+ L + I+YI +L ++ Sbjct: 35 RSKHSETEQRRRSKINERFQSLMDIIPQNQ----NDQKRDKASFLLEVIEYIHFLQEK 88 >At1g68920.2 68414.m07888 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 485 Score = 39.1 bits (87), Expect = 0.002 Identities = 32/100 (32%), Positives = 50/100 (50%), Gaps = 8/100 (8%) Frame = +1 Query: 211 QNIHQTPSS----SNQNTEDEDDSGDN-KASALSFKERRREA---HTQAEQKRRDAIKKG 366 +N Q+P+S SN + S D K + + RR +A H+ AE+ RR+ I + Sbjct: 268 RNDEQSPNSPGKKSNSGKQQGKQSSDPPKDGYIHVRARRGQATNSHSLAERVRREKISER 327 Query: 367 YDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 LQ+LVP C + KA +L + I+Y+Q L +Q Sbjct: 328 MKFLQDLVPGCNKVT------GKAVMLDEIINYVQSLQRQ 361 >At1g68920.1 68414.m07887 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 486 Score = 39.1 bits (87), Expect = 0.002 Identities = 32/100 (32%), Positives = 50/100 (50%), Gaps = 8/100 (8%) Frame = +1 Query: 211 QNIHQTPSS----SNQNTEDEDDSGDN-KASALSFKERRREA---HTQAEQKRRDAIKKG 366 +N Q+P+S SN + S D K + + RR +A H+ AE+ RR+ I + Sbjct: 269 RNDEQSPNSPGKKSNSGKQQGKQSSDPPKDGYIHVRARRGQATNSHSLAERVRREKISER 328 Query: 367 YDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 LQ+LVP C + KA +L + I+Y+Q L +Q Sbjct: 329 MKFLQDLVPGCNKVT------GKAVMLDEIINYVQSLQRQ 362 >At5g58010.1 68418.m07258 basic helix-loop-helix (bHLH) family protein bHLH transcription factor GBOF-1, Tulipa gesneriana, EMBL:AF185269; contains Pfam profile PF00010: Helix-loop-helix DNA-binding domain Length = 297 Score = 38.7 bits (86), Expect = 0.003 Identities = 22/57 (38%), Positives = 35/57 (61%) Frame = +1 Query: 316 EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 + H+ AE+ RR+ I + SLQELVP +TD KA++L + I+Y+++L Q Sbjct: 108 DPHSIAERLRRERIAERMKSLQELVPNTNKTD-------KASMLDEIIEYVRFLQLQ 157 >At4g28800.1 68417.m04118 bHLH family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 478 Score = 38.7 bits (86), Expect = 0.003 Identities = 18/64 (28%), Positives = 37/64 (57%), Gaps = 2/64 (3%) Frame = +1 Query: 229 PSSSNQNTEDEDDSGDNKASALSFKERRR--EAHTQAEQKRRDAIKKGYDSLQELVPTCQ 402 P++ ++ E+ G +A + ++R R E H AE++RR+ I + +LQ+L+P C Sbjct: 227 PATESKLKAREETHGTEEARGSTSRKRSRTAEMHNLAERRRREKINEKMKTLQQLIPRCN 286 Query: 403 QTDA 414 + ++ Sbjct: 287 KVES 290 >At4g27120.2 68417.m03898 expressed protein Length = 298 Score = 38.7 bits (86), Expect = 0.003 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 3/68 (4%) Frame = +1 Query: 193 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERR---REAHTQAEQKRRDAIKK 363 G+S S N+ + S S EDED++G +A A KE++ REA QAE+ R++ Sbjct: 64 GASSSTSNVQENGSGSED--EDEDEAGGTQARASKKKEKKRQEREAQRQAEEATRESRNT 121 Query: 364 GYDSLQEL 387 D E+ Sbjct: 122 KQDWYAEM 129 >At4g27120.1 68417.m03897 expressed protein Length = 298 Score = 38.7 bits (86), Expect = 0.003 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 3/68 (4%) Frame = +1 Query: 193 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERR---REAHTQAEQKRRDAIKK 363 G+S S N+ + S S EDED++G +A A KE++ REA QAE+ R++ Sbjct: 64 GASSSTSNVQENGSGSED--EDEDEAGGTQARASKKKEKKRQEREAQRQAEEATRESRNT 121 Query: 364 GYDSLQEL 387 D E+ Sbjct: 122 KQDWYAEM 129 >At5g08130.1 68418.m00948 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 409 Score = 38.3 bits (85), Expect = 0.003 Identities = 20/58 (34%), Positives = 32/58 (55%) Frame = +1 Query: 313 REAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 R H+ EQ+RR I + L++L+P Q K KA+ L + I+YIQ+L ++ Sbjct: 158 RSKHSATEQRRRSKINDRFQMLRQLIPNSDQ------KRDKASFLLEVIEYIQFLQEK 209 >At3g07340.1 68416.m00875 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 456 Score = 38.3 bits (85), Expect = 0.003 Identities = 30/103 (29%), Positives = 51/103 (49%), Gaps = 9/103 (8%) Frame = +1 Query: 205 SIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKE------RRREA---HTQAEQKRRDAI 357 S + I + S + + +++GD S +K+ RR +A H+ AE+ RR+ I Sbjct: 221 SSKEIEEKEDSDPKRCKKSEENGDKTKSIDPYKDYIHVRARRGQATDSHSLAERVRREKI 280 Query: 358 KKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 + LQ+LVP C + KA +L + I+Y+Q L +Q Sbjct: 281 SERMKLLQDLVPGCNKVT------GKALMLDEIINYVQSLQRQ 317 >At4g37850.1 68417.m05354 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 328 Score = 37.9 bits (84), Expect = 0.004 Identities = 22/82 (26%), Positives = 45/82 (54%) Frame = +1 Query: 241 NQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASG 420 +Q +++ + G +A S + + H AE+KRR+ + + + +L LVP ++ D Sbjct: 126 HQKSDEFNRKGTKRAQPFSRNQSNAQDHIIAERKRREKLTQRFVALSALVPGLKKMD--- 182 Query: 421 YKHSKAAVLQKSIDYIQYLLQQ 486 KA+VL ++ +I+YL ++ Sbjct: 183 ----KASVLGDALKHIKYLQER 200 >At4g34530.1 68417.m04907 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 335 Score = 37.9 bits (84), Expect = 0.004 Identities = 31/104 (29%), Positives = 50/104 (48%), Gaps = 6/104 (5%) Frame = +1 Query: 193 GSSGSIQNI-HQTPSSSNQNTEDEDDSGDN--KASALSFKERRREA---HTQAEQKRRDA 354 GS+ SI+ + H+ N + D K + + RR +A H+ AE+ RR+ Sbjct: 134 GSTKSIKKMKHKAKKEENNFSNDSSKVTKELEKTDYIHVRARRGQATDSHSIAERVRREK 193 Query: 355 IKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 I + LQ+LVP C + KA +L + I+Y+Q L +Q Sbjct: 194 ISERMKFLQDLVPGCDKIT------GKAGMLDEIINYVQSLQRQ 231 >At1g02340.1 68414.m00180 long hypocotyl in far-red 1 (HFR1) / reduced phytochrome signaling (REP1) / basic helix-loop-helix FBI1 protein (FBI1) / reduced sensitivity to far-red light (RSF1) / bHLH protein 26 (BHLH026) (BHLH26) identical to SP|Q9FE22 Long hypocotyl in far-red 1 (bHLH-like protein HFR1) (Reduced phytochrome signaling) (Basic helix-loop-helix FBI1 protein) (Reduced sensitivity to far-red light) [Arabidopsis thaliana] Length = 292 Score = 37.5 bits (83), Expect = 0.006 Identities = 24/93 (25%), Positives = 43/93 (46%) Frame = +1 Query: 208 IQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQEL 387 ++N H+ P DD + + R+ + ++K + ++K LQ+L Sbjct: 105 LRNKHENPKKRRIQVLSSDDESEEFTREVPSVTRKGSKRRRRDEKMSNKMRK----LQQL 160 Query: 388 VPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 VP C +TD K +VL K+I+Y++ L Q Sbjct: 161 VPNCHKTD-------KVSVLDKTIEYMKNLQLQ 186 >At5g67110.1 68418.m08461 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 210 Score = 37.1 bits (82), Expect = 0.008 Identities = 26/99 (26%), Positives = 52/99 (52%), Gaps = 2/99 (2%) Frame = +1 Query: 196 SSGSIQNIHQTPSSSNQNTE--DEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGY 369 S G++ ++ S + Q+ + SG + ++L + + H +E+KRR I + Sbjct: 55 SGGAVSSVGYGVSETGQDKYAFEHKRSGAKQRNSLK-RNIDAQFHNLSEKKRRSKINEKM 113 Query: 370 DSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 +LQ+L+P +TD KA++L ++I+Y++ L Q Sbjct: 114 KALQKLIPNSNKTD-------KASMLDEAIEYLKQLQLQ 145 >At1g59640.2 68414.m06708 basic helix-loop-helix (bHLH) family protein Length = 343 Score = 37.1 bits (82), Expect = 0.008 Identities = 28/87 (32%), Positives = 42/87 (48%), Gaps = 3/87 (3%) Frame = +1 Query: 235 SSNQNTEDEDDSGDNKASALSFKERRREA---HTQAEQKRRDAIKKGYDSLQELVPTCQQ 405 S TE + + + + RR +A H+ AE+ RR+ I + LQ+LVP C + Sbjct: 115 SLGTETEQKKQQMEPTKDYIHVRARRGQATDSHSLAERARREKISERMKILQDLVPGCNK 174 Query: 406 TDASGYKHSKAAVLQKSIDYIQYLLQQ 486 KA VL + I+YIQ L +Q Sbjct: 175 V------IGKALVLDEIINYIQSLQRQ 195 >At1g59640.1 68414.m06707 basic helix-loop-helix (bHLH) family protein Length = 264 Score = 37.1 bits (82), Expect = 0.008 Identities = 28/87 (32%), Positives = 42/87 (48%), Gaps = 3/87 (3%) Frame = +1 Query: 235 SSNQNTEDEDDSGDNKASALSFKERRREA---HTQAEQKRRDAIKKGYDSLQELVPTCQQ 405 S TE + + + + RR +A H+ AE+ RR+ I + LQ+LVP C + Sbjct: 115 SLGTETEQKKQQMEPTKDYIHVRARRGQATDSHSLAERARREKISERMKILQDLVPGCNK 174 Query: 406 TDASGYKHSKAAVLQKSIDYIQYLLQQ 486 KA VL + I+YIQ L +Q Sbjct: 175 V------IGKALVLDEIINYIQSLQRQ 195 >At3g57800.2 68416.m06443 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain; supported by full-length cDNA gi:20127059 Length = 379 Score = 36.7 bits (81), Expect = 0.010 Identities = 24/85 (28%), Positives = 43/85 (50%) Frame = +1 Query: 232 SSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTD 411 SS+ +N E++ + + + ++H+ AE+ RR+ I LQELVP C + Sbjct: 185 SSTKKNKSSEENEKLPYVHVRARRGQATDSHSLAERARREKINARMKLLQELVPGCDKIQ 244 Query: 412 ASGYKHSKAAVLQKSIDYIQYLLQQ 486 + A VL + I+++Q L +Q Sbjct: 245 GT------ALVLDEIINHVQSLQRQ 263 >At2g22750.1 68415.m02697 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 304 Score = 36.7 bits (81), Expect = 0.010 Identities = 21/69 (30%), Positives = 39/69 (56%) Frame = +1 Query: 271 GDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQ 450 G +A +L+ + + H AE+KRR+ + + + +L L+P ++ D KA+VL Sbjct: 110 GTKRAQSLTRSQSNAQDHILAERKRREKLTQRFVALSALIPGLKKMD-------KASVLG 162 Query: 451 KSIDYIQYL 477 +I +I+YL Sbjct: 163 DAIKHIKYL 171 >At5g62610.1 68418.m07857 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 281 Score = 36.3 bits (80), Expect = 0.014 Identities = 30/110 (27%), Positives = 53/110 (48%), Gaps = 4/110 (3%) Frame = +1 Query: 169 ICNMYSRCGSSGSIQNIHQTPSSSN-QNTEDEDDSGDNKASALSFKERRREA---HTQAE 336 +C S G GS++ +T S ++ + + + + RR +A H+ AE Sbjct: 110 LCGSESGNGD-GSMRPEGETSSGGGGSKATEQKNKPEPPKDYIHVRARRGQATDRHSLAE 168 Query: 337 QKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 + RR+ I + +LQ+++P C + KA VL + I+YIQ L +Q Sbjct: 169 RARREKISEKMTALQDIIPGCNKI------IGKALVLDEIINYIQSLQRQ 212 >At2g42300.1 68415.m05236 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 327 Score = 35.9 bits (79), Expect = 0.018 Identities = 30/100 (30%), Positives = 49/100 (49%), Gaps = 3/100 (3%) Frame = +1 Query: 196 SSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREA---HTQAEQKRRDAIKKG 366 SSG + + SS + + +S +K + + RR +A H+ AE+ RR+ I Sbjct: 153 SSGKRKEREKKVKSSTKKNKSSVES--DKLPYVHVRARRGQATDNHSLAERARREKINAR 210 Query: 367 YDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 LQELVP C + + A VL + I+++Q L +Q Sbjct: 211 MKLLQELVPGCDKIQGT------ALVLDEIINHVQTLQRQ 244 >At5g50915.2 68418.m06314 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 286 Score = 34.7 bits (76), Expect = 0.042 Identities = 20/57 (35%), Positives = 32/57 (56%) Frame = +1 Query: 316 EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 ++H+ AE+ RR+ I + +LQ LVP C + KA +L + I+Y+Q L Q Sbjct: 145 DSHSLAERVRREKISERMRTLQNLVPGCDKVT------GKALMLDEIINYVQTLQTQ 195 >At5g50915.1 68418.m06313 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 286 Score = 34.7 bits (76), Expect = 0.042 Identities = 20/57 (35%), Positives = 32/57 (56%) Frame = +1 Query: 316 EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 ++H+ AE+ RR+ I + +LQ LVP C + KA +L + I+Y+Q L Q Sbjct: 145 DSHSLAERVRREKISERMRTLQNLVPGCDKVT------GKALMLDEIINYVQTLQTQ 195 >At5g48560.1 68418.m06005 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 498 Score = 34.7 bits (76), Expect = 0.042 Identities = 20/57 (35%), Positives = 33/57 (57%) Frame = +1 Query: 316 EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 ++H+ AE+ RR+ I + LQ+LVP C + KA +L + I+Y+Q L +Q Sbjct: 310 DSHSLAERVRREKIGERMKLLQDLVPGCNKVT------GKALMLDEIINYVQSLQRQ 360 >At3g57800.1 68416.m06442 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain; supported by full-length cDNA gi:20127059 Length = 426 Score = 34.3 bits (75), Expect = 0.055 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = +1 Query: 232 SSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQ-T 408 SS+ +N E++ + + + ++H+ AE+ RR+ I LQELVP C + T Sbjct: 185 SSTKKNKSSEENEKLPYVHVRARRGQATDSHSLAERARREKINARMKLLQELVPGCDKGT 244 Query: 409 DASG 420 D G Sbjct: 245 DFGG 248 >At4g01720.1 68417.m00223 WRKY family transcription factor similar to wild oat DNA-binding protein ABF2, GenBank accession number Z48431 Length = 489 Score = 33.9 bits (74), Expect = 0.073 Identities = 20/81 (24%), Positives = 31/81 (38%) Frame = +1 Query: 193 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYD 372 GSSG + S ++ D DD + S L + R + D + + Y+ Sbjct: 69 GSSGFNDGLGLVNSCHGTSSNDGDDKTKTQISRLKLELERLHEENHKLKHLLDEVSESYN 128 Query: 373 SLQELVPTCQQTDASGYKHSK 435 LQ V +QT G H + Sbjct: 129 DLQRRVLLARQTQVEGLHHKQ 149 >At4g17880.1 68417.m02665 basic helix-loop-helix (bHLH) family protein bHLH protein, Arabidopsis thaliana, PATCHX:E255557 Length = 589 Score = 32.7 bits (71), Expect = 0.17 Identities = 20/68 (29%), Positives = 34/68 (50%) Frame = +1 Query: 322 HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQXXXXX 501 H +AE++RR+ + + + SL+ +VP + D KA++L +I YI L + Sbjct: 417 HVEAERQRREKLNQRFYSLRAVVPNVSKMD-------KASLLGDAISYISELKSKLQKAE 469 Query: 502 XXXNALQK 525 LQK Sbjct: 470 SDKEELQK 477 >At1g76180.1 68414.m08846 dehydrin (ERD14) identical to SP|P42763 Dehydrin ERD14 {Arabidopsis thaliana} Length = 185 Score = 32.7 bits (71), Expect = 0.17 Identities = 17/63 (26%), Positives = 38/63 (60%), Gaps = 1/63 (1%) Frame = +1 Query: 208 IQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGY-DSLQE 384 ++ +H++ SSS+ ++E+E G+ + K+ +++ T+ E K + KKG+ + L+E Sbjct: 71 LEKLHRSDSSSSSSSEEEGSDGEKRKK----KKEKKKPTTEVEVKEEE--KKGFMEKLKE 124 Query: 385 LVP 393 +P Sbjct: 125 KLP 127 >At1g25330.1 68414.m03143 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 223 Score = 32.7 bits (71), Expect = 0.17 Identities = 21/57 (36%), Positives = 32/57 (56%) Frame = +1 Query: 316 EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 ++H+ AE+ RR+ I + LQ+LVP C + A G A +L IDY++ L Q Sbjct: 113 DSHSLAERVRREKINERLKCLQDLVPGCYK--AMG----MAVMLDVIIDYVRSLQNQ 163 >At5g46760.1 68418.m05760 basic helix-loop-helix (bHLH) family protein Length = 592 Score = 31.9 bits (69), Expect = 0.29 Identities = 19/68 (27%), Positives = 34/68 (50%) Frame = +1 Query: 322 HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQXXXXX 501 H +AE++RR+ + + + SL+ +VP + D KA++L +I YI L + Sbjct: 416 HVEAERQRREKLNQRFYSLRAVVPNVSKMD-------KASLLGDAISYINELKSKLQQAE 468 Query: 502 XXXNALQK 525 +QK Sbjct: 469 SDKEEIQK 476 >At2g40200.1 68415.m04943 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 254 Score = 31.9 bits (69), Expect = 0.29 Identities = 21/71 (29%), Positives = 35/71 (49%) Frame = +1 Query: 274 DNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQK 453 D+ + E +H AE++RRD I +L++LVP + D KAA+L Sbjct: 51 DDCVGGIEKAESLSRSHRLAEKRRRDRINSHLTALRKLVPNSDKLD-------KAALLAT 103 Query: 454 SIDYIQYLLQQ 486 I+ ++ L Q+ Sbjct: 104 VIEQVKELKQK 114 >At2g31210.1 68415.m03811 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain; PMID: 12679534 Length = 428 Score = 31.5 bits (68), Expect = 0.39 Identities = 25/92 (27%), Positives = 45/92 (48%), Gaps = 8/92 (8%) Frame = +1 Query: 226 TPSSSNQNTEDEDDSGDNKASALSF-KERRREAHTQ-------AEQKRRDAIKKGYDSLQ 381 T N DE+++ + + F KE RR+ + E++RR + + Y++L+ Sbjct: 175 TTQRDESNVGDENNNAQFDSGIIEFSKEIRRKGRGKRKNKPFTTERERRCHLNERYEALK 234 Query: 382 ELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 477 L+P+ + D +A++LQ IDYI L Sbjct: 235 LLIPSPSKGD-------RASILQDGIDYINEL 259 >At1g50410.1 68414.m05650 SNF2 domain-containing protein / helicase domain-containing protein / RING finger domain-containing protein similar to transcription factor RUSH-1alpha [Oryctolagus cuniculus] GI:1655930; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 981 Score = 31.5 bits (68), Expect = 0.39 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = +1 Query: 160 ITDICNMYSRCGSSGSIQNIHQTPSSSNQNTEDEDDSGDN 279 + DI S G+S S QN Q SSS Q +D+DD D+ Sbjct: 770 VLDILQSLSNQGTSNSTQN-GQMASSSQQPNDDDDDDDDD 808 >At1g27740.1 68414.m03390 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 258 Score = 31.5 bits (68), Expect = 0.39 Identities = 29/98 (29%), Positives = 44/98 (44%), Gaps = 11/98 (11%) Frame = +1 Query: 226 TPSSSNQNTED----EDDSGDNKASALSFKERRREAHTQAE-------QKRRDAIKKGYD 372 T SN N D + S D KAS S K + R A +KRR+ I + Sbjct: 135 TVDESNTNWVDGQSLSNSSDDEKASVTSVKGKTRATKGTATDPQSLYARKRREKINERLK 194 Query: 373 SLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 +LQ LVP + D S +L++++ Y+++L Q Sbjct: 195 TLQNLVPNGTKVDIS-------TMLEEAVHYVKFLQLQ 225 >At1g01260.1 68414.m00043 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 590 Score = 31.5 bits (68), Expect = 0.39 Identities = 22/76 (28%), Positives = 41/76 (53%), Gaps = 4/76 (5%) Frame = +1 Query: 262 DDSGDNKASALSFKER--RREA--HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKH 429 D+SG+N+ + R EA H +AE++RR+ + + + +L+ +VP + D Sbjct: 410 DESGNNRPRKRGRRPANGRAEALNHVEAERQRREKLNQRFYALRSVVPNISKMD------ 463 Query: 430 SKAAVLQKSIDYIQYL 477 KA++L ++ YI L Sbjct: 464 -KASLLGDAVSYINEL 478 >At3g28770.1 68416.m03591 expressed protein Length = 2081 Score = 31.1 bits (67), Expect = 0.51 Identities = 14/77 (18%), Positives = 40/77 (51%) Frame = +1 Query: 223 QTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQ 402 ++ + ++ ED+ + DNK+ ++ ++ H +++ ++++ KK + L++ + Sbjct: 1072 ESENHKSKKKEDKKEHEDNKSMKKEEDKKEKKKHEESKSRKKEEDKKDMEKLEDQNSNKK 1131 Query: 403 QTDASGYKHSKAAVLQK 453 + D + K S+ L K Sbjct: 1132 KEDKNEKKKSQHVKLVK 1148 >At3g20640.1 68416.m02612 ethylene-responsive protein -related contains similarity to ethylene-inducible ER33 protein [Lycopersicon esculentum] gi|5669656|gb|AAD46413 Length = 454 Score = 31.1 bits (67), Expect = 0.51 Identities = 23/85 (27%), Positives = 41/85 (48%) Frame = +1 Query: 232 SSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTD 411 S ++ +E G N + + + A KR++ + +LQ+LV +TD Sbjct: 309 SEIRDSSSNEVKRGGNDHQPAAKRAKSEAASPSPAFKRKEKMGDRIAALQQLVSPFGKTD 368 Query: 412 ASGYKHSKAAVLQKSIDYIQYLLQQ 486 A A+VL ++I+YI++L QQ Sbjct: 369 A-------ASVLSEAIEYIKFLHQQ 386 >At1g61660.2 68414.m06950 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 347 Score = 31.1 bits (67), Expect = 0.51 Identities = 25/97 (25%), Positives = 48/97 (49%), Gaps = 6/97 (6%) Frame = +1 Query: 214 NIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKR------RDAIKKGYDS 375 N TP + ED+ + +A + S K R ++ + A++ R K ++ Sbjct: 227 NFVTTPQIISTRLEDKTKNLKTRAQSESLK-RAKDNESAAKKPRVTTPSPLPTFKVRKEN 285 Query: 376 LQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 L++ + + QQ + K A+VLQ++I+YI++L Q Sbjct: 286 LRDQITSLQQLVSPFGKTDTASVLQEAIEYIKFLHDQ 322 >At1g61660.1 68414.m06949 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 393 Score = 31.1 bits (67), Expect = 0.51 Identities = 25/97 (25%), Positives = 48/97 (49%), Gaps = 6/97 (6%) Frame = +1 Query: 214 NIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKR------RDAIKKGYDS 375 N TP + ED+ + +A + S K R ++ + A++ R K ++ Sbjct: 227 NFVTTPQIISTRLEDKTKNLKTRAQSESLK-RAKDNESAAKKPRVTTPSPLPTFKVRKEN 285 Query: 376 LQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 L++ + + QQ + K A+VLQ++I+YI++L Q Sbjct: 286 LRDQITSLQQLVSPFGKTDTASVLQEAIEYIKFLHDQ 322 >At1g25310.1 68414.m03141 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 145 Score = 31.1 bits (67), Expect = 0.51 Identities = 11/29 (37%), Positives = 21/29 (72%) Frame = +1 Query: 325 TQAEQKRRDAIKKGYDSLQELVPTCQQTD 411 T ++KRR+ I++ ++L+E+ P C Q+D Sbjct: 72 TLLKKKRRERIRRQLETLKEITPNCPQSD 100 >At1g22450.1 68414.m02806 cytochrome c oxidase subunit 6b, putative (COX6b) nearly identical to subunit 6b of cytochrome c oxidase [Arabidopsis thaliana] GI:6518353 Length = 191 Score = 31.1 bits (67), Expect = 0.51 Identities = 20/73 (27%), Positives = 35/73 (47%) Frame = +1 Query: 223 QTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQ 402 QTPS S Q +++ D A + KE E TQAE+ + + K+ ++E V + Sbjct: 8 QTPSLSEQYHLEKEVKQDTSAKPVEVKEVAPEVTTQAEEVKTEQAKE-ESPVEEAVSVVE 66 Query: 403 QTDASGYKHSKAA 441 + S + ++ A Sbjct: 67 EKSESAPESTEVA 79 >At5g41315.1 68418.m05021 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain ;annotation temporarily based on supporting cDNA gi|17224394|gb|AF246291.1|AF246291 Length = 637 Score = 30.3 bits (65), Expect = 0.89 Identities = 14/52 (26%), Positives = 31/52 (59%) Frame = +1 Query: 322 HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 477 H E+KRR+ + + + +L++++P+ + D K ++L +I+Y+Q L Sbjct: 442 HAVLEKKRREKLNERFMTLRKIIPSINKID-------KVSILDDTIEYLQEL 486 >At5g37800.1 68418.m04552 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 307 Score = 30.3 bits (65), Expect = 0.89 Identities = 28/107 (26%), Positives = 46/107 (42%), Gaps = 1/107 (0%) Frame = +1 Query: 169 ICNMYSRCGSSGSIQNIHQTP-SSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKR 345 I N+ SR S+ ++ P + N + SG N ++ + A + R Sbjct: 160 IVNIGSRHESTSPKLAGNKRPFTGENTQLSKKPSSGTNGKIKPKATTSPKDPQSLAAKNR 219 Query: 346 RDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 R+ I + LQELVP G K +L+K+I Y+++L Q Sbjct: 220 RERISERLKVLQELVPN-------GTKVDLVTMLEKAIGYVKFLQVQ 259 >At4g29930.1 68417.m04258 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 254 Score = 30.3 bits (65), Expect = 0.89 Identities = 17/52 (32%), Positives = 30/52 (57%) Frame = +1 Query: 331 AEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 +E+ RR + + +L+ +VP + D KA+V++ SIDY+Q L+ Q Sbjct: 58 SERNRRQKLNQRLFALRSVVPNISKLD-------KASVIKDSIDYMQELIDQ 102 >At4g00870.1 68417.m00118 basic helix-loop-helix (bHLH) family protein similar to the myc family of helix-loop-helix transcription factors; contains Pfam profile PF00010: Helix-loop-helix DNA-binding domain; PMID: 12679534 Length = 423 Score = 30.3 bits (65), Expect = 0.89 Identities = 19/66 (28%), Positives = 36/66 (54%), Gaps = 3/66 (4%) Frame = +1 Query: 289 ALSFKERRREA---HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSI 459 A + KE+ A H +AE++RR+ + + +L+ +VP + D KA++L ++ Sbjct: 236 AAATKEKHHPAVLSHVEAEKQRREKLNHRFYALRAIVPKVSRMD-------KASLLSDAV 288 Query: 460 DYIQYL 477 YI+ L Sbjct: 289 SYIESL 294 >At3g19510.1 68416.m02472 homeobox protein (HAT 3.1) identical to homeotic protein HAT 3.1 (GI:11994474) [Arabidopsis thaliana] Length = 723 Score = 30.3 bits (65), Expect = 0.89 Identities = 15/54 (27%), Positives = 25/54 (46%) Frame = +1 Query: 229 PSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELV 390 P N N DED S DN+ S T A + ++ K+G D +++++ Sbjct: 377 PDCLNDNENDEDGSDDNEESENEDGSSDETEFTSASDEMIESFKEGKDIMKDVM 430 >At2g46510.1 68415.m05796 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 566 Score = 30.3 bits (65), Expect = 0.89 Identities = 16/55 (29%), Positives = 33/55 (60%) Frame = +1 Query: 322 HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 H +AE++RR+ + + + +L+ +VP + D KA++L +I YI+ L ++ Sbjct: 396 HVEAERQRREKLNQRFYALRSVVPNISKMD-------KASLLGDAISYIKELQEK 443 >At2g44200.1 68415.m05500 expressed protein Length = 493 Score = 30.3 bits (65), Expect = 0.89 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = +1 Query: 220 HQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIK 360 HQ SSS Q ++ E+DSG+ S ++ H + ++ R ++ Sbjct: 191 HQKQSSSRQRSDSEEDSGEENNGRKSHHQKTSGTHDRHYERPRSDLE 237 >At2g14760.1 68415.m01667 basic helix-loop-helix protein / bHLH protein contains Pfam profile PF00010: Helix-loop-helix DNA-binding domain; PMID: 12679534; putative bHLH084 transcription factor Length = 328 Score = 30.3 bits (65), Expect = 0.89 Identities = 25/81 (30%), Positives = 42/81 (51%), Gaps = 5/81 (6%) Frame = +1 Query: 259 EDDSGDNKASALSFKERR-REAHTQAE----QKRRDAIKKGYDSLQELVPTCQQTDASGY 423 ++D D+KA L+ K R R A T + +KRR+ I + LQ LVP + D S Sbjct: 222 KEDGEDSKALNLNGKTRASRGAATDPQSLYARKRRERINERLRILQHLVPNGTKVDIS-- 279 Query: 424 KHSKAAVLQKSIDYIQYLLQQ 486 +L++++ Y+++L Q Sbjct: 280 -----TMLEEAVQYVKFLQLQ 295 >At1g63650.2 68414.m07202 basic helix-loop-helix (bHLH) family protein similar to bHLH transcription factor (JAF13) GB:AAC39455 [Petunia x hybrida]; contains Pfam profile: PF00010 Helix-loop-helix DNA-binding domain Length = 596 Score = 30.3 bits (65), Expect = 0.89 Identities = 14/52 (26%), Positives = 31/52 (59%) Frame = +1 Query: 322 HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 477 H +E+KRR+ + + + +L+ ++P+ + D K ++L +I+Y+Q L Sbjct: 406 HALSEKKRREKLNERFMTLRSIIPSISKID-------KVSILDDTIEYLQDL 450 >At1g63650.1 68414.m07201 basic helix-loop-helix (bHLH) family protein similar to bHLH transcription factor (JAF13) GB:AAC39455 [Petunia x hybrida]; contains Pfam profile: PF00010 Helix-loop-helix DNA-binding domain Length = 596 Score = 30.3 bits (65), Expect = 0.89 Identities = 14/52 (26%), Positives = 31/52 (59%) Frame = +1 Query: 322 HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 477 H +E+KRR+ + + + +L+ ++P+ + D K ++L +I+Y+Q L Sbjct: 406 HALSEKKRREKLNERFMTLRSIIPSISKID-------KVSILDDTIEYLQDL 450 >At3g29075.1 68416.m03637 glycine-rich protein Length = 294 Score = 29.5 bits (63), Expect = 1.6 Identities = 16/61 (26%), Positives = 30/61 (49%) Frame = +1 Query: 193 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYD 372 G G I++ + PS ED+ D G K S + + ++ + ++K++D K G + Sbjct: 121 GYGGRIESDYVKPSYGGH--EDDGDDGHKKHSGKDYDDGDEKSKKKEKEKKKDKKKDGNN 178 Query: 373 S 375 S Sbjct: 179 S 179 >At3g25710.1 68416.m03199 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 344 Score = 29.5 bits (63), Expect = 1.6 Identities = 16/57 (28%), Positives = 34/57 (59%) Frame = +1 Query: 316 EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 ++H++AE++RR+ I L+ ++P +TD KA++L + I +++ L +Q Sbjct: 134 KSHSEAERRRRERINTHLAKLRSILPNTTKTD-------KASLLAEVIQHMKELKRQ 183 >At1g68810.1 68414.m07866 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 368 Score = 29.5 bits (63), Expect = 1.6 Identities = 15/57 (26%), Positives = 34/57 (59%) Frame = +1 Query: 316 EAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 ++H++AE++RR+ I L+ ++P +TD KA++L + I +++ L ++ Sbjct: 176 KSHSEAERRRRERINNHLAKLRSILPNTTKTD-------KASLLAEVIQHVKELKRE 225 >At5g63720.1 68418.m07998 hypothetical protein Length = 492 Score = 29.1 bits (62), Expect = 2.1 Identities = 20/68 (29%), Positives = 30/68 (44%), Gaps = 5/68 (7%) Frame = +1 Query: 223 QTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGY-----DSLQEL 387 QTPS++ +EDE+ S + S + E TQAE + Y DS+ E+ Sbjct: 272 QTPSATGSESEDEEVSTSQEYSGETGSSSGSEWETQAENDTESKSESSYPPQNDDSVSEV 331 Query: 388 VPTCQQTD 411 + TD Sbjct: 332 STSPPHTD 339 >At5g43650.1 68418.m05335 basic helix-loop-helix (bHLH) family protein similar to unknown protein (pir||T04030) Length = 247 Score = 29.1 bits (62), Expect = 2.1 Identities = 17/68 (25%), Positives = 35/68 (51%) Frame = +1 Query: 274 DNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQK 453 + K + ++ ++ R H E+ RR+ K+ Y +L L+P + D K ++++K Sbjct: 74 EEKKNTVAPEKERSRRHMLKERTRREKQKQSYLALHSLLPFATKND-------KNSIVEK 126 Query: 454 SIDYIQYL 477 ++D I L Sbjct: 127 AVDEIAKL 134 >At4g38600.2 68417.m05463 HECT-domain-containing protein / ubiquitin-transferase family protein similar to SP|Q14669Thyroid receptor interacting protein 12 (TRIP12) {Homo sapiens}; contains Pfam profile PF00632: HECT-domain (ubiquitin-transferase) Length = 1794 Score = 29.1 bits (62), Expect = 2.1 Identities = 17/61 (27%), Positives = 21/61 (34%) Frame = +1 Query: 247 NTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYK 426 N D D G K + +ER RE EQ DA S E + G+ Sbjct: 20 NNNDNSDKGKEKEHDVRIRERERERDRAREQLNMDAAAAAARSADEDDDNDSEDGNGGFM 79 Query: 427 H 429 H Sbjct: 80 H 80 >At4g38600.1 68417.m05464 HECT-domain-containing protein / ubiquitin-transferase family protein similar to SP|Q14669Thyroid receptor interacting protein 12 (TRIP12) {Homo sapiens}; contains Pfam profile PF00632: HECT-domain (ubiquitin-transferase) Length = 1888 Score = 29.1 bits (62), Expect = 2.1 Identities = 17/61 (27%), Positives = 21/61 (34%) Frame = +1 Query: 247 NTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYK 426 N D D G K + +ER RE EQ DA S E + G+ Sbjct: 93 NNNDNSDKGKEKEHDVRIRERERERDRAREQLNMDAAAAAARSADEDDDNDSEDGNGGFM 152 Query: 427 H 429 H Sbjct: 153 H 153 >At2g45130.1 68415.m05616 SPX (SYG1/Pho81/XPR1) domain-containing protein weak similarity to NUC-2 [Neurospora crassa] GI:1399532, xenotropic and polytropic murine leukemia virus receptor [Mus musculus castaneus] GI:6093320; contains Pfam profile PF03105: SPX domain Length = 245 Score = 29.1 bits (62), Expect = 2.1 Identities = 25/89 (28%), Positives = 41/89 (46%), Gaps = 6/89 (6%) Frame = +2 Query: 131 DKILRFQLYKSLIYATCTLGVVAVGLYKTSIKLRRLLIKIQKTKMTVEIIRHRHLVLKKG 310 DK LR++ K+LI + + + VGL I Q+ II H+ L + Sbjct: 20 DKFLRYKELKNLISSPAPVESIFVGLLNAEIDKFNAFFVEQEEDF---IIHHKELQYR-- 74 Query: 311 EEKLTPKQNRNEEM------PLRKDMIHF 379 ++L K N+EM +RKD+++F Sbjct: 75 IQRLVEKCGHNDEMSRENISEIRKDIVNF 103 >At1g66470.1 68414.m07551 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 298 Score = 29.1 bits (62), Expect = 2.1 Identities = 18/58 (31%), Positives = 30/58 (51%) Frame = +1 Query: 313 REAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 ++ + A + RR+ I + LQELVP G K +L+K+I Y+++L Q Sbjct: 203 KDPQSLAAKNRRERISERLKILQELVPN-------GTKVDLVTMLEKAISYVKFLQVQ 253 >At1g12860.1 68414.m01494 basic helix-loop-helix (bHLH) family protein / F-box family protein contains Pfam profiles: PF00646 F-box domain, PF00010 helix-loop-helix DNA-binding domain Length = 828 Score = 29.1 bits (62), Expect = 2.1 Identities = 22/83 (26%), Positives = 40/83 (48%) Frame = +1 Query: 238 SNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDAS 417 S N E +D + +N K+ + AE++RR + L+ +VP + D Sbjct: 621 SGLNYESDDHNTNNNKGK---KKGMPAKNLMAERRRRKKLNDRLYMLRSVVPKISKMD-- 675 Query: 418 GYKHSKAAVLQKSIDYIQYLLQQ 486 +A++L +IDY++ LLQ+ Sbjct: 676 -----RASILGDAIDYLKELLQR 693 >At4g16430.1 68417.m02487 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 467 Score = 28.7 bits (61), Expect = 2.7 Identities = 18/55 (32%), Positives = 32/55 (58%), Gaps = 2/55 (3%) Frame = +1 Query: 310 RREA--HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYI 468 R EA H +AE++RR+ + + + +L+ +VP + D KA++L +I YI Sbjct: 315 REEALNHVEAERQRREKLNQRFYALRAVVPNISKMD-------KASLLADAITYI 362 >At3g30725.1 68416.m03909 expressed protein ; expression supported by MPSS Length = 111 Score = 28.7 bits (61), Expect = 2.7 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 2/28 (7%) Frame = +1 Query: 220 HQTPSSSNQNT--EDEDDSGDNKASALS 297 HQ PSSS+ N ++EDD GD A ++ Sbjct: 39 HQKPSSSSNNNHMDEEDDVGDKDAKPIT 66 >At2g22770.1 68415.m02701 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 314 Score = 28.7 bits (61), Expect = 2.7 Identities = 17/55 (30%), Positives = 31/55 (56%) Frame = +1 Query: 322 HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 H AE+KRR + + +L L+P ++TD KA VL+ +I +++ L ++ Sbjct: 127 HVLAERKRRQKLNERLIALSALLPGLKKTD-------KATVLEDAIKHLKQLQER 174 >At2g20310.1 68415.m02372 expressed protein Length = 430 Score = 28.7 bits (61), Expect = 2.7 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +1 Query: 163 TDICNMYSRCGSSGSIQNIHQTPSSSNQNTEDEDD 267 TDI + S G + + ++ P+SSNQ ED+DD Sbjct: 45 TDIVEVLSEV--RGGVNSQYRKPNSSNQALEDDDD 77 >At2g06210.2 68415.m00683 phosphoprotein-related low similarity to phosphoprotein from Mus musculus GI:1236239; contains Pfam profile PF00515 TPR Domain Length = 852 Score = 28.7 bits (61), Expect = 2.7 Identities = 17/57 (29%), Positives = 29/57 (50%) Frame = +1 Query: 226 TPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPT 396 TP S+ + EDD G++K S ERRR+ + +K + + + Y+ +E T Sbjct: 691 TPGSNKRKDRVEDDDGESKPS-----ERRRKKGGKRRKKDKSSRARHYEDDEEEAAT 742 >At2g06210.1 68415.m00684 phosphoprotein-related low similarity to phosphoprotein from Mus musculus GI:1236239; contains Pfam profile PF00515 TPR Domain Length = 1064 Score = 28.7 bits (61), Expect = 2.7 Identities = 17/57 (29%), Positives = 29/57 (50%) Frame = +1 Query: 226 TPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPT 396 TP S+ + EDD G++K S ERRR+ + +K + + + Y+ +E T Sbjct: 903 TPGSNKRKDRVEDDDGESKPS-----ERRRKKGGKRRKKDKSSRARHYEDDEEEAAT 954 >At4g09820.1 68417.m01611 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 379 Score = 28.3 bits (60), Expect = 3.6 Identities = 17/75 (22%), Positives = 36/75 (48%) Frame = +1 Query: 319 AHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQXXXX 498 +H AE++RR+ + + + +L+ +VP + D K ++L +I Y+ +L ++ Sbjct: 224 SHVVAERRRREKLNEKFITLRSMVPFVTKMD-------KVSILGDTIAYVNHLRKRVHEL 276 Query: 499 XXXXNALQKGCGRAC 543 + Q R C Sbjct: 277 ENTHHEQQHKRTRTC 291 >At3g30775.1 68416.m03933 proline oxidase, mitochondrial / osmotic stress-responsive proline dehydrogenase (POX) (PRO1) (ERD5) nearly identical to SP|P92983 Proline oxidase, mitochondrial precursor (EC 1.5.3.-) (Osmotic stress- induced proline dehydrogenase) [Arabidopsis thaliana]; identical to cDNA proline oxidase precursor GI:1817543 Length = 499 Score = 28.3 bits (60), Expect = 3.6 Identities = 13/48 (27%), Positives = 28/48 (58%) Frame = +1 Query: 331 AEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQY 474 AE++R ++ + +QE+ CQ+++ ++ +LQ +IDY+ Y Sbjct: 252 AEEERE--LEAAHGRIQEICRKCQESNVPLLIDAEDTILQPAIDYMAY 297 >At2g31730.1 68415.m03874 ethylene-responsive protein, putative similar to ethylene-inducible ER33 protein [Lycopersicon esculentum] gi|5669656|gb|AAD46413 Length = 153 Score = 28.3 bits (60), Expect = 3.6 Identities = 19/76 (25%), Positives = 40/76 (52%), Gaps = 5/76 (6%) Frame = +1 Query: 274 DNKASALSFKERRREAHTQAE-----QKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKA 438 + K + S ++ + + H ++ ++R+D + + +LQ+LV +TD A Sbjct: 13 ETKRNVYSLEDNKIKRHKSSDLSFSSKERKDKLAERISALQQLVSPYGKTDT-------A 65 Query: 439 AVLQKSIDYIQYLLQQ 486 +VL + + YIQ+L +Q Sbjct: 66 SVLLEGMQYIQFLQEQ 81 >At2g28160.1 68415.m03420 basic helix-loop-helix (bHLH) family protein Length = 318 Score = 28.3 bits (60), Expect = 3.6 Identities = 23/86 (26%), Positives = 43/86 (50%), Gaps = 8/86 (9%) Frame = +1 Query: 253 EDEDD--SGDNKASALSFKERRREAHTQ------AEQKRRDAIKKGYDSLQELVPTCQQT 408 EDE+D GD+ ++ + + R+ T +E++RR +K +L+ LVP + Sbjct: 101 EDEEDYNDGDDSSATTTNNDGTRKTKTDRSRTLISERRRRGRMKDKLYALRSLVPNITKM 160 Query: 409 DASGYKHSKAAVLQKSIDYIQYLLQQ 486 D KA+++ ++ Y+Q L Q Sbjct: 161 D-------KASIVGDAVLYVQELQSQ 179 >At2g02480.1 68415.m00187 DNA polymerase-related weak similarity to DNA polymerase III holoenzyme tau subunit [Thermus thermophilus] GI:2583049 Length = 1218 Score = 28.3 bits (60), Expect = 3.6 Identities = 19/88 (21%), Positives = 33/88 (37%) Frame = +1 Query: 193 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYD 372 GS S H S + +DD +++K+R H IK+ + Sbjct: 800 GSMPSPGTTHTGSSRRQSSRATDDDPASVSREVMAYKQRIGGLHFSKSASPASVIKRNGN 859 Query: 373 SLQELVPTCQQTDASGYKHSKAAVLQKS 456 E P + D + YK S ++ + +S Sbjct: 860 HSHEAKPFSRVIDNNCYKSSSSSQMIES 887 >At1g32640.1 68414.m04026 basic helix-loop-helix (bHLH) protein (RAP-1) identical to bHLH protein GB:CAA67885 GI:1465368 from [Arabidopsis thaliana] Length = 623 Score = 28.3 bits (60), Expect = 3.6 Identities = 16/52 (30%), Positives = 30/52 (57%) Frame = +1 Query: 322 HTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYL 477 H +AE++RR+ + + + +L+ +VP + D KA++L +I YI L Sbjct: 453 HVEAERQRREKLNQRFYALRAVVPNVSKMD-------KASLLGDAIAYINEL 497 >At5g16500.1 68418.m01928 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 636 Score = 27.9 bits (59), Expect = 4.8 Identities = 12/43 (27%), Positives = 26/43 (60%) Frame = +1 Query: 208 IQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAE 336 +++IH + S +Q+ +DD+G++ S+L E + E H ++ Sbjct: 593 LEHIHSS-KSEDQSVYSDDDAGESGESSLHRIEAKEEEHISSD 634 >At3g21480.1 68416.m02710 transcription activation domain-interacting protein-related contains weak similarity to Pax transcription activation domain interacting protein PTIP (GI:4336734) [Mus musculus] Length = 1045 Score = 27.9 bits (59), Expect = 4.8 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 241 NQNTEDEDDSGDNKASALSFKERRREAHTQAE 336 N + D DDSG + LS +E R++A+ + + Sbjct: 128 NSDLSDSDDSGSKAETVLSSEENRQDANEKVK 159 >At1g17820.1 68414.m02206 expressed protein Length = 803 Score = 27.9 bits (59), Expect = 4.8 Identities = 15/65 (23%), Positives = 33/65 (50%) Frame = +1 Query: 193 GSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYD 372 GSS + + Q+PS S ++E++D G + + ++ + E+KRR +K Sbjct: 736 GSSREVSAV-QSPSRSVASSEEDDSRGKKQGRRARMLDLGKKMGEKLEEKRRHMEEKSRQ 794 Query: 373 SLQEL 387 ++++ Sbjct: 795 IVEKM 799 >At5g41090.1 68418.m04995 no apical meristem (NAM) family protein contains Pfam PF02365: No apical meristem (NAM) domain; similar to unknown protein (emb|CAB88055.1) Length = 212 Score = 27.5 bits (58), Expect = 6.3 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +1 Query: 214 NIHQTPSSSNQNTEDEDDSGDNKASAL-SFKER 309 N+H S S E+ED+S D A +L S KE+ Sbjct: 168 NLHIVESESESEEEEEDESVDKPAESLDSVKEK 200 >At4g33880.1 68417.m04807 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 352 Score = 27.5 bits (58), Expect = 6.3 Identities = 22/85 (25%), Positives = 39/85 (45%), Gaps = 7/85 (8%) Frame = +1 Query: 253 EDEDDSGDNKASALSFKERRREAHTQAE-------QKRRDAIKKGYDSLQELVPTCQQTD 411 ED D+ + AL+ + R + A +KRR+ I + LQ LVP + D Sbjct: 247 EDSSSKEDDPSKALNLNGKTRASRGAATDPQSLYARKRRERINERLRILQNLVPNGTKVD 306 Query: 412 ASGYKHSKAAVLQKSIDYIQYLLQQ 486 S +L++++ Y+++L Q Sbjct: 307 IS-------TMLEEAVHYVKFLQLQ 324 >At4g04890.1 68417.m00712 homeobox-leucine zipper protein protodermal factor 2 (PDF2) identical to GP|14276060| protodermal factor2 (GI:14276060) Length = 743 Score = 27.5 bits (58), Expect = 6.3 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +2 Query: 251 QKTKMTVEIIRHRHLVLKKGEEKLTPKQNRNEE 349 ++T+M + RH + +LK +KL + NR +E Sbjct: 113 KRTQMKAQSERHENQILKSDNDKLRAENNRYKE 145 >At3g14010.1 68416.m01769 hydroxyproline-rich glycoprotein family protein similar to Mrs16p (GI:2737884) [Saccharomyces cerevisiae]; weak similarity to ataxin-2 related protein (GI:1679686) [Homo sapiens] Length = 595 Score = 27.5 bits (58), Expect = 6.3 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +1 Query: 196 SSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDA 354 SS +N+ Q+ S+S Q ++D +G N S E+RR+ + + R A Sbjct: 330 SSRKNKNVDQSCSTSKQQSKDFPAAGSN-ISESQLDEQRRKNNEEVSHNNRSA 381 >At2g41130.1 68415.m05080 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 253 Score = 27.5 bits (58), Expect = 6.3 Identities = 28/103 (27%), Positives = 46/103 (44%) Frame = +1 Query: 178 MYSRCGSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAI 357 M S CGSS S + + S T +D + +AL H +AE++RR+ I Sbjct: 34 MQSLCGSSSSTSSYYPLAISGIGETMAQDRA----LAAL-------RNHKEAERRRRERI 82 Query: 358 KKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLLQQ 486 + L+ ++ +TD KA +L K + ++ L QQ Sbjct: 83 NSHLNKLRNVLSCNSKTD-------KATLLAKVVQRVRELKQQ 118 >At2g03810.2 68415.m00341 18S pre-ribosomal assembly protein gar2-related contains weak similarity to Swiss-Prot:P41891 protein gar2 [Schizosaccharomyces pombe] Length = 439 Score = 27.5 bits (58), Expect = 6.3 Identities = 20/79 (25%), Positives = 32/79 (40%), Gaps = 2/79 (2%) Frame = +1 Query: 175 NMYSRCGSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHT--QAEQKRR 348 N C + G I + S NQ+ D + S L KE+R T + E ++ Sbjct: 242 NDSKECLTLGDILSREDEQKSLNQDNISSDSHEEQSPSQLQDKEKRSLETTAIETELEKT 301 Query: 349 DAIKKGYDSLQELVPTCQQ 405 + K+G + L + T Q Sbjct: 302 EEPKQGEEKLSSVSTTTSQ 320 >At2g03810.1 68415.m00340 18S pre-ribosomal assembly protein gar2-related contains weak similarity to Swiss-Prot:P41891 protein gar2 [Schizosaccharomyces pombe] Length = 439 Score = 27.5 bits (58), Expect = 6.3 Identities = 20/79 (25%), Positives = 32/79 (40%), Gaps = 2/79 (2%) Frame = +1 Query: 175 NMYSRCGSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHT--QAEQKRR 348 N C + G I + S NQ+ D + S L KE+R T + E ++ Sbjct: 242 NDSKECLTLGDILSREDEQKSLNQDNISSDSHEEQSPSQLQDKEKRSLETTAIETELEKT 301 Query: 349 DAIKKGYDSLQELVPTCQQ 405 + K+G + L + T Q Sbjct: 302 EEPKQGEEKLSSVSTTTSQ 320 >At1g77500.1 68414.m09025 expressed protein contains Pfam domains, PF04782: Protein of unknown function (DUF632) and PF04783: Protein of unknown function (DUF630) Length = 879 Score = 27.5 bits (58), Expect = 6.3 Identities = 28/110 (25%), Positives = 50/110 (45%) Frame = +2 Query: 188 GVVAVGLYKTSIKLRRLLIKIQKTKMTVEIIRHRHLVLKKGEEKLTPKQNRNEEMPLRKD 367 G ++ + T +R+LL KI +V+ I R + K +E+L P+ + L Sbjct: 584 GAESIKIDATRAAIRKLLTKIDVCIRSVDSISSR--IHKLRDEELQPQL-----IQLIHG 636 Query: 368 MIHFKSWFLPVNKLMHQAISTVKLQSFKNP*TISNTYYSKGVVXRKNEMR 517 +I L ++ QAI K++S K T+ N S ++ + E+R Sbjct: 637 LIRMWRSMLRCHQKQFQAIRESKVRSLKANTTLQNDSGSTAILDLEIELR 686 >At1g57680.2 68414.m06546 expressed protein Length = 362 Score = 27.5 bits (58), Expect = 6.3 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = -2 Query: 414 CISLLTGRNQLLK*IISFLNGISSFLFCL 328 C+S+LT ++++ +SFL +S F FC+ Sbjct: 256 CLSVLTAADKIIFEALSFLAFLSLFCFCV 284 >At1g57680.1 68414.m06545 expressed protein Length = 362 Score = 27.5 bits (58), Expect = 6.3 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = -2 Query: 414 CISLLTGRNQLLK*IISFLNGISSFLFCL 328 C+S+LT ++++ +SFL +S F FC+ Sbjct: 256 CLSVLTAADKIIFEALSFLAFLSLFCFCV 284 >At1g52160.1 68414.m05887 metallo-beta-lactamase family protein Length = 890 Score = 27.5 bits (58), Expect = 6.3 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Frame = +1 Query: 199 SGSIQNIHQTPSSSNQNTEDEDDSGDNKAS-ALSFKERRREAHTQAEQKRRDAIKKGYDS 375 S S+ + + SSS+ +E +G +S + F +RR E ++K+R+ +K Sbjct: 36 SFSLSTLFSSSSSSSSMENNEATNGSKSSSNSFVFNKRRAEGFDITDKKKRNLERKS--- 92 Query: 376 LQELVPT 396 Q+L PT Sbjct: 93 -QKLNPT 98 >At1g30670.1 68414.m03750 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 264 Score = 27.5 bits (58), Expect = 6.3 Identities = 18/62 (29%), Positives = 30/62 (48%) Frame = +1 Query: 301 KERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVLQKSIDYIQYLL 480 K+R A + A +KRR I + L +L+P Q KH+ A + + Y+++L Sbjct: 132 KKRELSAQSIAARKRRRRITEKTQELGKLIPGSQ-------KHNTAEMFNAAAKYVKFLQ 184 Query: 481 QQ 486 Q Sbjct: 185 AQ 186 >At1g14687.1 68414.m01755 zinc finger homeobox family protein / ZF-HD homeobox family protein Length = 168 Score = 27.5 bits (58), Expect = 6.3 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +1 Query: 232 SSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIK 360 ++ +N E+EDD+ + +RRR++ AEQ R+A+K Sbjct: 82 TAEERNEEEEDDTEETSTEEKMTVQRRRKSKFTAEQ--REAMK 122 >At1g10610.1 68414.m01202 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 421 Score = 27.5 bits (58), Expect = 6.3 Identities = 24/89 (26%), Positives = 41/89 (46%), Gaps = 3/89 (3%) Frame = +1 Query: 223 QTPSSSNQNTEDE--DDSGDNKASA-LSFKERRREAHTQAEQKRRDAIKKGYDSLQELVP 393 QTP +D ++ D+KA+ L E + + +E+KRR+ I + L+ +VP Sbjct: 229 QTPCLIMNKEKDVVVQNANDSKANKKLLPTENFKSKNLHSERKRRERINQAMYGLRAVVP 288 Query: 394 TCQQTDASGYKHSKAAVLQKSIDYIQYLL 480 K +K + ++DYI LL Sbjct: 289 KIT-------KLNKIGIFSDAVDYINELL 310 >At5g56960.1 68418.m07110 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 466 Score = 27.1 bits (57), Expect = 8.3 Identities = 25/94 (26%), Positives = 42/94 (44%), Gaps = 3/94 (3%) Frame = +1 Query: 175 NMYSRCGSSGSIQNIHQTPSSSNQN--TEDEDDSGDNKASAL-SFKERRREAHTQAEQKR 345 +M +R S + NI+Q + +N T E G S + H +E+KR Sbjct: 238 SMMTRAMSFYNRLNINQRERFTRENATTHGEGSGGSGGGGRYTSGPSATQLQHMISERKR 297 Query: 346 RDAIKKGYDSLQELVPTCQQTDASGYKHSKAAVL 447 R+ + + + +L+ L+P G K KA+VL Sbjct: 298 REKLNESFQALRSLLP-------PGTKKDKASVL 324 >At4g29550.1 68417.m04214 expressed protein contains Pfam profile PF04776: Protein of unknown function (DUF626) Length = 358 Score = 27.1 bits (57), Expect = 8.3 Identities = 14/53 (26%), Positives = 28/53 (52%) Frame = +1 Query: 163 TDICNMYSRCGSSGSIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREA 321 T + + S CG + +++ P S + T+++DD+ D +S+ KE +A Sbjct: 13 TTVSHDVSSCGFISKEEWLNKHPPSGSGWTDEDDDNDDVFSSSFISKEELSDA 65 >At4g27290.1 68417.m03916 S-locus protein kinase, putative similar to S-receptor kinase gi|392557|gb|AAA62232; contains Pfam domains PF00954: S-locus glycoprotein family, PF00069: Protein kinase domain and PF01453: Lectin (probable mannose binding) Length = 772 Score = 27.1 bits (57), Expect = 8.3 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +1 Query: 166 DICNMYSRCGSSGSIQNIHQTPS 234 D C+ Y+ CGS GS NI+++P+ Sbjct: 278 DSCDQYTLCGSYGSC-NINESPA 299 >At3g29763.1 68416.m03760 hypothetical protein Length = 505 Score = 27.1 bits (57), Expect = 8.3 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +2 Query: 269 VEIIRHRHLVLKKGEEKLTPKQNRNEEMPLRKDMIH 376 ++ I ++ V+KK K PK N+ P++KD++H Sbjct: 78 LKYIAGQNEVVKKVVLKNAPKNNQMTSPPIQKDIVH 113 >At2g16910.1 68415.m01948 basic helix-loop-helix (bHLH) family protein Length = 571 Score = 27.1 bits (57), Expect = 8.3 Identities = 21/82 (25%), Positives = 39/82 (47%) Frame = +1 Query: 232 SSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKRRDAIKKGYDSLQELVPTCQQTD 411 S + +DEDD K S + + + AE++RR + +L+ LVP + D Sbjct: 289 SDCSDQIDDEDDPKYKKKSGKGSQAK----NLMAERRRRKKLNDRLYALRSLVPRITKLD 344 Query: 412 ASGYKHSKAAVLQKSIDYIQYL 477 +A++L +I+Y++ L Sbjct: 345 -------RASILGDAINYVKEL 359 >At1g29570.1 68414.m03616 zinc finger protein-related contains similarity to zinc finger proteins (CCCH type) Length = 321 Score = 27.1 bits (57), Expect = 8.3 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Frame = +1 Query: 205 SIQNIHQTPSSSNQNTEDEDDSGDNKASALSFKERRREAHTQAEQKR-RDAIKKGYDSLQ 381 ++Q Q S Q E E++ + + S + +RREA +Q+R RD+I++ Q Sbjct: 186 NLQEQRQRDSIERQRREAEENLQEQRQRD-SIERQRREAQENLQQQRQRDSIERQRREAQ 244 Query: 382 E 384 E Sbjct: 245 E 245 >At1g19260.1 68414.m02396 hAT dimerisation domain-containing protein Length = 769 Score = 27.1 bits (57), Expect = 8.3 Identities = 13/39 (33%), Positives = 25/39 (64%), Gaps = 3/39 (7%) Frame = +2 Query: 269 VEIIRH---RHLVLKKGEEKLTPKQNRNEEMPLRKDMIH 376 VE++++ ++ V+KK K PK N+ P++KD++H Sbjct: 207 VELLKYTAGQNEVVKKVVLKNAPKNNQMTSPPIQKDIVH 245 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,158,809 Number of Sequences: 28952 Number of extensions: 219232 Number of successful extensions: 1144 Number of sequences better than 10.0: 122 Number of HSP's better than 10.0 without gapping: 1084 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1131 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1043173136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -